BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0150.0038.p
         (50 letters)

Database: BlastDatabases/689/689 
           4735 sequences; 1,619,870 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|300309593|ref|YP_003773685.1| heat shock protein 15 [Herbaspi...    64   2e-12

>gi|300309593|ref|YP_003773685.1| heat shock protein 15
           [Herbaspirillum seropedicae SmR1]
          Length = 124

 Score = 64.3 bits (155), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 38/50 (76%)

Query: 1   VAQGLYGETAASVEKRRLLAEQHHFFKEPTAALKGRPTKRDRRLLDQSSS 50
           +A  LY ET  S+ +R   AE+H  F+EP+A +KGRPTKRDRRLLD+SSS
Sbjct: 75  IAATLYQETEESIARRAAQAERHRLFREPSAEIKGRPTKRDRRLLDRSSS 124


  Database: BlastDatabases/689/689
    Posted date:  Apr 10, 2011 12:15 AM
  Number of letters in database: 1,619,870
  Number of sequences in database:  4735
  
Lambda     K      H
   0.315    0.129    0.353 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 4735
Number of Hits to DB: 142,208
Number of extensions: 3402
Number of successful extensions: 14
Number of sequences better than 1.0e-08: 1
Number of HSP's gapped: 14
Number of HSP's successfully gapped: 1
Length of query: 50
Length of database: 1,619,870
Length adjustment: 23
Effective length of query: 27
Effective length of database: 1,510,965
Effective search space: 40796055
Effective search space used: 40796055
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 123 (52.0 bits)