BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0148.0038.p (158 letters) Database: BlastDatabases/689/689 4735 sequences; 1,619,870 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|300309515|ref|YP_003773607.1| leucine-responsive regulatory p... 296 5e-82 gi|300311014|ref|YP_003775106.1| leucine-responsive regulatory D... 159 9e-41 gi|300312490|ref|YP_003776582.1| transcription regulator protein... 126 1e-30 gi|300310455|ref|YP_003774547.1| AsnC family transcription regul... 100 8e-23 gi|300311006|ref|YP_003775098.1| transcription regulator protein... 100 1e-22 >gi|300309515|ref|YP_003773607.1| leucine-responsive regulatory protein [Herbaspirillum seropedicae SmR1] Length = 154 Score = 296 bits (758), Expect = 5e-82, Method: Compositional matrix adjust. Identities = 147/158 (93%), Positives = 150/158 (94%), Gaps = 4/158 (2%) Query: 1 MATLDKISKKILSKILSELQNDGRISNVDLAARVNLSPAACLERVRKLQDAGYILGYAAQ 60 MA LDKISKKIL+ ELQNDGRISNVDLAARVNLSPAACLERVRKLQ+AGYILGYAAQ Sbjct: 1 MAGLDKISKKILA----ELQNDGRISNVDLAARVNLSPAACLERVRKLQEAGYILGYAAQ 56 Query: 61 LNPELLDVSLLVFIEVVLDRTTADVFEAFKKSVQSIPEIMECHMVAGGFDYLVKSRVKDM 120 LNPELLDVSLLVFIEVVLDRTT DVF FKKSVQSIPEIMECHMVAGGFDYLVKSRVKDM Sbjct: 57 LNPELLDVSLLVFIEVVLDRTTPDVFAEFKKSVQSIPEIMECHMVAGGFDYLVKSRVKDM 116 Query: 121 NAYREFLGKSLLQLKGVRETHTYAVMEEVKNTIRLPIK 158 NAYREFLGKSLLQLKGVRETHTYAVMEEVKNTIRLPI+ Sbjct: 117 NAYREFLGKSLLQLKGVRETHTYAVMEEVKNTIRLPIR 154 >gi|300311014|ref|YP_003775106.1| leucine-responsive regulatory DNA-binding transcription regulator protein [Herbaspirillum seropedicae SmR1] Length = 162 Score = 159 bits (403), Expect = 9e-41, Method: Compositional matrix adjust. Identities = 74/155 (47%), Positives = 108/155 (69%), Gaps = 4/155 (2%) Query: 3 TLDKISKKILSKILSELQNDGRISNVDLAARVNLSPAACLERVRKLQDAGYILGYAAQLN 62 TLDK+ +IL+ LQ DGRIS +L +V LS C+ERVR+++ G I GY A++N Sbjct: 10 TLDKLDHRILAV----LQKDGRISMKELGEQVGLSVTPCIERVRRMERDGVITGYYARVN 65 Query: 63 PELLDVSLLVFIEVVLDRTTADVFEAFKKSVQSIPEIMECHMVAGGFDYLVKSRVKDMNA 122 PE L +LLVF+E+ L+ + ++FE F++ V IPE+ ECH+V+G FDYL+K+R++ M Sbjct: 66 PESLGATLLVFVEITLNHKSGNMFEQFRREVLRIPEVQECHLVSGDFDYLIKARIRGMAE 125 Query: 123 YREFLGKSLLQLKGVRETHTYAVMEEVKNTIRLPI 157 YR+ LG LLQL G ++ +Y VMEE+K T+ LP+ Sbjct: 126 YRKLLGDILLQLPGAAQSKSYVVMEEIKETLALPL 160 >gi|300312490|ref|YP_003776582.1| transcription regulator protein [Herbaspirillum seropedicae SmR1] Length = 153 Score = 126 bits (316), Expect = 1e-30, Method: Compositional matrix adjust. Identities = 63/156 (40%), Positives = 98/156 (62%), Gaps = 4/156 (2%) Query: 3 TLDKISKKILSKILSELQNDGRISNVDLAARVNLSPAACLERVRKLQDAGYILGYAAQLN 62 +LD++ K+IL LQ DGRI N +LA ++ +S AC ++L + GY+ A L+ Sbjct: 2 SLDRMDKRILKA----LQKDGRIGNAELAKKLGMSATACWNHTKRLMEEGYVKEVRAILD 57 Query: 63 PELLDVSLLVFIEVVLDRTTADVFEAFKKSVQSIPEIMECHMVAGGFDYLVKSRVKDMNA 122 PE L + +LV + VVLDR+T + F F+K+V+ I + EC ++AG FDY +K RVKD+ A Sbjct: 58 PEKLGLPVLVTVGVVLDRSTPESFAEFEKAVRDIAAVQECLLLAGEFDYWIKLRVKDLQA 117 Query: 123 YREFLGKSLLQLKGVRETHTYAVMEEVKNTIRLPIK 158 + +LL+L GVR+ ++ V+ EVKN L ++ Sbjct: 118 FNRLHANTLLRLPGVRQLRSFFVLNEVKNNPELVVE 153 >gi|300310455|ref|YP_003774547.1| AsnC family transcription regulator protein [Herbaspirillum seropedicae SmR1] Length = 164 Score = 99.8 bits (247), Expect = 8e-23, Method: Compositional matrix adjust. Identities = 52/134 (38%), Positives = 82/134 (61%) Query: 14 KILSELQNDGRISNVDLAARVNLSPAACLERVRKLQDAGYILGYAAQLNPELLDVSLLVF 73 +IL LQ + RI+NV LA V LSP+ CL RV++L+ AGYI GY A + E L +VF Sbjct: 15 RILCHLQQNSRITNVILADAVGLSPSPCLIRVKRLEKAGYISGYGAYIRLEKLADVQIVF 74 Query: 74 IEVVLDRTTADVFEAFKKSVQSIPEIMECHMVAGGFDYLVKSRVKDMNAYREFLGKSLLQ 133 EV L + F F+ +++++ EI+ECH+V+GG+DYL+K + + Y+ + L Q Sbjct: 75 TEVTLSDHRREDFAKFESTIRNVDEIIECHLVSGGYDYLLKFMTRSVVHYQSVIESLLEQ 134 Query: 134 LKGVRETHTYAVME 147 + + +Y V++ Sbjct: 135 NLRIEKYFSYIVIK 148 >gi|300311006|ref|YP_003775098.1| transcription regulator protein [Herbaspirillum seropedicae SmR1] Length = 172 Score = 99.8 bits (247), Expect = 1e-22, Method: Compositional matrix adjust. Identities = 51/144 (35%), Positives = 86/144 (59%) Query: 15 ILSELQNDGRISNVDLAARVNLSPAACLERVRKLQDAGYILGYAAQLNPELLDVSLLVFI 74 +L+ELQ DG I+N L +V+LS + RV++L++A I Y A L+P ++ + + F Sbjct: 13 LLTELQRDGHITNSALGQKVHLSTSQISRRVQRLEEAHVIERYTAVLDPAVVGLGVTAFT 72 Query: 75 EVVLDRTTADVFEAFKKSVQSIPEIMECHMVAGGFDYLVKSRVKDMNAYREFLGKSLLQL 134 V LDR E F+K+V+++PE+ EC V G DY+++ D+ A+ EF+ LL+L Sbjct: 73 TVTLDRQGETRGELFEKAVETMPEVTECFSVTGEGDYILRIVAPDLAAFSEFMMTRLLRL 132 Query: 135 KGVRETHTYAVMEEVKNTIRLPIK 158 GV + +++VK + LP++ Sbjct: 133 PGVTNVKSNITLKKVKQSHELPLE 156 Database: BlastDatabases/689/689 Posted date: Apr 10, 2011 12:15 AM Number of letters in database: 1,619,870 Number of sequences in database: 4735 Lambda K H 0.321 0.136 0.370 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 4735 Number of Hits to DB: 387,299 Number of extensions: 13377 Number of successful extensions: 43 Number of sequences better than 1.0e-08: 9 Number of HSP's gapped: 43 Number of HSP's successfully gapped: 9 Length of query: 158 Length of database: 1,619,870 Length adjustment: 78 Effective length of query: 80 Effective length of database: 1,250,540 Effective search space: 100043200 Effective search space used: 100043200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 127 (53.5 bits)