BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0147.0013.p (168 letters) Database: BlastDatabases/689/689 4735 sequences; 1,619,870 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|300310848|ref|YP_003774940.1| two component sensor histidine ... 184 5e-48 gi|300313666|ref|YP_003777758.1| two component sensor histidine ... 84 5e-18 gi|300313829|ref|YP_003777921.1| sensor histidine kinase [Herbas... 75 2e-15 >gi|300310848|ref|YP_003774940.1| two component sensor histidine kinase [Herbaspirillum seropedicae SmR1] Length = 465 Score = 184 bits (466), Expect = 5e-48, Method: Compositional matrix adjust. Identities = 93/115 (80%), Positives = 100/115 (86%) Query: 1 LQTPLTRLRLRLEKVEDKELQQKLVDDLAVMQIMVREGLDLARSMDSSEAMQRLDIDSLL 60 LQTPLTR+RLRLEKV D LQQKL+DDL VM MVREGLDLARSMDSSE +Q LDIDSLL Sbjct: 266 LQTPLTRMRLRLEKVSDPGLQQKLIDDLGVMHGMVREGLDLARSMDSSEKIQALDIDSLL 325 Query: 61 DSVCADASDAGQQVELQGRTRAFVVAQPNALRRCLTNLLDNAFKYGQRAEVSIAL 115 DSVCADA+DAGQ V LQG TRAFV+AQP ALRRCLTNL+DNA KYG+ A VSIAL Sbjct: 326 DSVCADAADAGQDVALQGSTRAFVMAQPGALRRCLTNLIDNACKYGKSARVSIAL 380 >gi|300313666|ref|YP_003777758.1| two component sensor histidine kinase [Herbaspirillum seropedicae SmR1] Length = 479 Score = 84.3 bits (207), Expect = 5e-18, Method: Compositional matrix adjust. Identities = 44/113 (38%), Positives = 72/113 (63%), Gaps = 1/113 (0%) Query: 1 LQTPLTRLRLRLEKVEDKELQQKLVDDLAVMQIMVREGLDLARSMDSSEAMQRLDIDSLL 60 L++P+TR++LR E + D+ ++K DL M ++ L++ + +D E Q +D+DSLL Sbjct: 288 LRSPITRMKLRTEMLPDERGKEKFRKDLDEMDALISATLNVVQDIDVQERPQLIDLDSLL 347 Query: 61 DSVCADASDAGQQVELQGRTRAFVVAQPNALRRCLTNLLDNAFKYGQRAEVSI 113 +S+ D ++ G +V L G A + P +LRRCL NL++NA +YGQRA V + Sbjct: 348 ESLRTDQAEVGGEVTLSGHA-APLQGYPRSLRRCLQNLVENAVRYGQRARVQL 399 >gi|300313829|ref|YP_003777921.1| sensor histidine kinase [Herbaspirillum seropedicae SmR1] Length = 478 Score = 75.5 bits (184), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 45/130 (34%), Positives = 71/130 (54%), Gaps = 8/130 (6%) Query: 1 LQTPLTRLRLRLEKVEDKELQQKLVDDLAVMQIMVREGLDLARSMDSSEAMQRLDIDSLL 60 L+TP+TRL+LR E ++D ++ DDL + +MV+ L + D E + +D+L+ Sbjct: 282 LRTPITRLKLRTELMDDDAMRTDFHDDLDELDMMVKGALQSVKDSDIHENRTEVRLDALV 341 Query: 61 DSVCADASDAGQQVELQGRTRAFVVAQPNALRRCLTNLLDNAFKYGQRAEVSIALLWRRQ 120 + DA AG ++ + V+A+P AL+R + NL DNA YGQ+ E+SI Sbjct: 342 LRMIRDARLAGHEIAFT-PSGINVIAKPLALKRAIGNLFDNALYYGQKVEISI------- 393 Query: 121 RTGCGXAGNL 130 R G G+L Sbjct: 394 RPSPGAEGDL 403 Database: BlastDatabases/689/689 Posted date: Apr 10, 2011 12:15 AM Number of letters in database: 1,619,870 Number of sequences in database: 4735 Lambda K H 0.324 0.135 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 4735 Number of Hits to DB: 444,000 Number of extensions: 15724 Number of successful extensions: 96 Number of sequences better than 1.0e-08: 3 Number of HSP's gapped: 95 Number of HSP's successfully gapped: 3 Length of query: 168 Length of database: 1,619,870 Length adjustment: 79 Effective length of query: 89 Effective length of database: 1,245,805 Effective search space: 110876645 Effective search space used: 110876645 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 127 (53.5 bits)