BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0141.0011.p (76 letters) Database: BlastDatabases/689/689 4735 sequences; 1,619,870 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|300311881|ref|YP_003775973.1| amino acid ABC transporter ATPa... 148 7e-38 gi|300310285|ref|YP_003774377.1| branched-chain amino acid ABC t... 84 2e-18 gi|300310994|ref|YP_003775086.1| branched-chain amino acid ABC t... 79 7e-17 gi|300309521|ref|YP_003773613.1| branched-chain amino acid ABC t... 75 9e-16 gi|300310523|ref|YP_003774615.1| branched-chain amino acid ABC t... 75 1e-15 >gi|300311881|ref|YP_003775973.1| amino acid ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 293 Score = 148 bits (374), Expect = 7e-38, Method: Compositional matrix adjust. Identities = 71/76 (93%), Positives = 74/76 (97%) Query: 1 MAGMNVEEKQDMCRFILDVNEQFGTTIVLIEHDMGVVMDISDRVVVLDYGKKIGDGTPDE 60 MAGMNVEEKQDMCRFILDVN+QFGTTIVLIEHDMGVVMDISDRVVVLDYGKKIGDGTP+E Sbjct: 218 MAGMNVEEKQDMCRFILDVNDQFGTTIVLIEHDMGVVMDISDRVVVLDYGKKIGDGTPEE 277 Query: 61 VMANPEVIKAYLGTSH 76 VM N +VIKAYLGTSH Sbjct: 278 VMGNEDVIKAYLGTSH 293 >gi|300310285|ref|YP_003774377.1| branched-chain amino acid ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 263 Score = 84.3 bits (207), Expect = 2e-18, Method: Composition-based stats. Identities = 40/76 (52%), Positives = 51/76 (67%) Query: 1 MAGMNVEEKQDMCRFILDVNEQFGTTIVLIEHDMGVVMDISDRVVVLDYGKKIGDGTPDE 60 MAGM V EK +M F+ +QF T I+LIEHD+G+V +SDRVVVL +G KI DG P Sbjct: 184 MAGMTVTEKSEMADFVRAARDQFDTAILLIEHDIGLVFGLSDRVVVLHHGSKIADGAPAA 243 Query: 61 VMANPEVIKAYLGTSH 76 V + VI+AYLG + Sbjct: 244 VRQDAAVIEAYLGVAQ 259 >gi|300310994|ref|YP_003775086.1| branched-chain amino acid ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 258 Score = 79.0 bits (193), Expect = 7e-17, Method: Composition-based stats. Identities = 34/72 (47%), Positives = 54/72 (75%) Query: 2 AGMNVEEKQDMCRFILDVNEQFGTTIVLIEHDMGVVMDISDRVVVLDYGKKIGDGTPDEV 61 AG+N +EKQ++ + I + + G ++LIEHDM ++M ISDR++V+++GK I GTP++V Sbjct: 185 AGLNPQEKQELSQLIDRLRREHGVAVLLIEHDMSLIMGISDRILVMEHGKPIVTGTPEQV 244 Query: 62 MANPEVIKAYLG 73 ++ VIKAYLG Sbjct: 245 RSDERVIKAYLG 256 >gi|300309521|ref|YP_003773613.1| branched-chain amino acid ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 255 Score = 75.1 bits (183), Expect = 9e-16, Method: Composition-based stats. Identities = 35/75 (46%), Positives = 50/75 (66%), Gaps = 1/75 (1%) Query: 2 AGMNVEEKQDMCRFILDVNEQFGTTIVLIEHDMGVVMDISDRVVVLDYGKKIGDGTPDEV 61 AGMN EK + ++ + + G TI+LIEHD+ ++M + +R+ VLDYGK I +G P +V Sbjct: 182 AGMNATEKLGLRELLVKIQAE-GKTILLIEHDVKLMMGLCNRITVLDYGKPIAEGVPADV 240 Query: 62 MANPEVIKAYLGTSH 76 NP VI+AYLG H Sbjct: 241 QKNPAVIEAYLGAGH 255 >gi|300310523|ref|YP_003774615.1| branched-chain amino acid ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 255 Score = 75.1 bits (183), Expect = 1e-15, Method: Composition-based stats. Identities = 35/75 (46%), Positives = 50/75 (66%), Gaps = 1/75 (1%) Query: 2 AGMNVEEKQDMCRFILDVNEQFGTTIVLIEHDMGVVMDISDRVVVLDYGKKIGDGTPDEV 61 AGMN EK + ++ + + G TI+LIEHD+ ++M + +R+ VLDYGK I +G P +V Sbjct: 182 AGMNATEKLGLRELLVKIQAE-GKTILLIEHDVKLMMGLCNRITVLDYGKPIAEGVPADV 240 Query: 62 MANPEVIKAYLGTSH 76 NP VI+AYLG H Sbjct: 241 QKNPAVIEAYLGAGH 255 Database: BlastDatabases/689/689 Posted date: Apr 10, 2011 12:15 AM Number of letters in database: 1,619,870 Number of sequences in database: 4735 Lambda K H 0.320 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 4735 Number of Hits to DB: 241,637 Number of extensions: 8459 Number of successful extensions: 139 Number of sequences better than 1.0e-08: 17 Number of HSP's gapped: 140 Number of HSP's successfully gapped: 17 Length of query: 76 Length of database: 1,619,870 Length adjustment: 47 Effective length of query: 29 Effective length of database: 1,397,325 Effective search space: 40522425 Effective search space used: 40522425 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 123 (52.0 bits)