BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0109.0008.p (103 letters) Database: BlastDatabases/689/689 4735 sequences; 1,619,870 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|300309716|ref|YP_003773808.1| nitrate/sulfonate/bicarbonate A... 82 8e-18 gi|300310817|ref|YP_003774909.1| nitrate/sulfonate/bicarbonate A... 68 1e-13 gi|300310979|ref|YP_003775071.1| alkanesulfonates ABC transporte... 64 2e-12 gi|300309985|ref|YP_003774077.1| nitrate/sulfonate/bicarbonate A... 62 1e-11 gi|300311644|ref|YP_003775736.1| taurine ABC transporter permeas... 60 5e-11 >gi|300309716|ref|YP_003773808.1| nitrate/sulfonate/bicarbonate ABC transporter permease [Herbaspirillum seropedicae SmR1] Length = 273 Score = 82.0 bits (201), Expect = 8e-18, Method: Compositional matrix adjust. Identities = 42/93 (45%), Positives = 64/93 (68%) Query: 3 GANQGQLLRFVILPAAMPSIFAGLRIGIGSAWMLTVTAEMVAVKSGLGYALWDSYYFLRY 62 GA+Q L V+LPAA+P I +G+RIGIG+A+++ + AEM+AV +GLG+ + ++ + Sbjct: 177 GASQSTLFLRVMLPAAVPYILSGVRIGIGTAFIVVIVAEMIAVSNGLGFRIMEAREYFWS 236 Query: 63 DLVIAAMISIGLLGYLADLILKLIMNSVLRWQH 95 D +IA MI+IGLLG DL + + N +LRW Sbjct: 237 DKIIAGMITIGLLGLAIDLGMSRLNNYMLRWHR 269 >gi|300310817|ref|YP_003774909.1| nitrate/sulfonate/bicarbonate ABC transporter permease [Herbaspirillum seropedicae SmR1] Length = 256 Score = 67.8 bits (164), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 33/89 (37%), Positives = 58/89 (65%) Query: 3 GANQGQLLRFVILPAAMPSIFAGLRIGIGSAWMLTVTAEMVAVKSGLGYALWDSYYFLRY 62 GA Q ++L VILP+ +P + G RI +G++++ V+AE+V+ + GLG +W + F R Sbjct: 164 GAGQWKILSTVILPSTVPFMVTGARIAMGNSFLTVVSAEIVSAREGLGALIWTARNFSRT 223 Query: 63 DLVIAAMISIGLLGYLADLILKLIMNSVL 91 + V +I++G+LGYL D +L++ +L Sbjct: 224 EWVFVGIIALGILGYLFDRVLRVATRKLL 252 >gi|300310979|ref|YP_003775071.1| alkanesulfonates ABC transporter permease [Herbaspirillum seropedicae SmR1] Length = 279 Score = 64.3 bits (155), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 33/86 (38%), Positives = 52/86 (60%) Query: 9 LLRFVILPAAMPSIFAGLRIGIGSAWMLTVTAEMVAVKSGLGYALWDSYYFLRYDLVIAA 68 L R VILP A+P+I GLR +G W+L + AE ++ ++G+GY ++ FL+ D+V+ Sbjct: 190 LYRDVILPGALPAILVGLRFALGLVWVLLIVAETISAQAGIGYMTMNAREFLQTDVVLVG 249 Query: 69 MISIGLLGYLADLILKLIMNSVLRWQ 94 ++ LLG LAD + + LRW Sbjct: 250 ILLYALLGKLADTAARWLERFWLRWH 275 >gi|300309985|ref|YP_003774077.1| nitrate/sulfonate/bicarbonate ABC transporter permease [Herbaspirillum seropedicae SmR1] Length = 278 Score = 62.0 bits (149), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 39/94 (41%), Positives = 59/94 (62%) Query: 2 AGANQGQLLRFVILPAAMPSIFAGLRIGIGSAWMLTVTAEMVAVKSGLGYALWDSYYFLR 61 +G N L+ ++LPA++P +FAGLR G+ AWM V AE++A G+GY L D R Sbjct: 175 SGLNTQALIGHILLPASLPYLFAGLRGGLSLAWMFLVAAELIAATKGVGYLLSDGRESSR 234 Query: 62 YDLVIAAMISIGLLGYLADLILKLIMNSVLRWQH 95 DLV+AA++ + LLG L+D +L+ + L W+ Sbjct: 235 PDLVLAAILILALLGKLSDGLLRAVEQKSLGWRE 268 >gi|300311644|ref|YP_003775736.1| taurine ABC transporter permease [Herbaspirillum seropedicae SmR1] Length = 293 Score = 59.7 bits (143), Expect = 5e-11, Method: Compositional matrix adjust. Identities = 30/92 (32%), Positives = 51/92 (55%) Query: 3 GANQGQLLRFVILPAAMPSIFAGLRIGIGSAWMLTVTAEMVAVKSGLGYALWDSYYFLRY 62 GA + QLL V+LP+A+P I G+RI +G W V AE++A G+GY + + +FL Sbjct: 199 GATRWQLLTEVVLPSALPEILTGIRIALGVGWSTLVAAELIASNRGIGYMIMSASHFLAT 258 Query: 63 DLVIAAMISIGLLGYLADLILKLIMNSVLRWQ 94 D V + I + ++L+ +++ W+ Sbjct: 259 DAVFVGIALIATCAFAFSYGMRLLERALVPWK 290 Database: BlastDatabases/689/689 Posted date: Apr 10, 2011 12:15 AM Number of letters in database: 1,619,870 Number of sequences in database: 4735 Lambda K H 0.328 0.140 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 4735 Number of Hits to DB: 334,213 Number of extensions: 12427 Number of successful extensions: 86 Number of sequences better than 1.0e-08: 10 Number of HSP's gapped: 86 Number of HSP's successfully gapped: 10 Length of query: 103 Length of database: 1,619,870 Length adjustment: 71 Effective length of query: 32 Effective length of database: 1,283,685 Effective search space: 41077920 Effective search space used: 41077920 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 123 (52.0 bits)