BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0100.0033.p (108 letters) Database: BlastDatabases/689/689 4735 sequences; 1,619,870 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|300309402|ref|YP_003773494.1| nitrate/sulfonate/bicarbonate A... 188 8e-50 gi|300311841|ref|YP_003775933.1| nitrate/sulfonate/bicarbonate A... 117 2e-28 gi|300309717|ref|YP_003773809.1| nitrate/sulfonate/bicarbonate A... 82 1e-17 gi|300311645|ref|YP_003775737.1| taurine ABC transporter ATPase ... 73 4e-15 gi|300309802|ref|YP_003773894.1| nitrate/sulfonate/bicarbonate A... 65 1e-12 >gi|300309402|ref|YP_003773494.1| nitrate/sulfonate/bicarbonate ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 290 Score = 188 bits (477), Expect = 8e-50, Method: Compositional matrix adjust. Identities = 94/114 (82%), Positives = 99/114 (86%), Gaps = 6/114 (5%) Query: 1 MDEPFAALDALTRRKMQEELLILWEEVRFTLLFVTHSIEEALVVGNRILLLSPHPGRVRA 60 MDEPFAALDALTRRKMQEELL LW+EVRFTLLFVTHSIEEALVVGNRILLLSPHPGRVRA Sbjct: 177 MDEPFAALDALTRRKMQEELLALWDEVRFTLLFVTHSIEEALVVGNRILLLSPHPGRVRA 236 Query: 61 EINSHQYDLQSLGGVGFQETARRIHRLLFNEGHGEP------AQVNFKDVRFSY 108 EINSHQYDL SLGGVGFQ+TA+RIHRLLF+EG +NF DVRFSY Sbjct: 237 EINSHQYDLSSLGGVGFQQTAQRIHRLLFDEGGPSDAASAAAPTLNFSDVRFSY 290 >gi|300311841|ref|YP_003775933.1| nitrate/sulfonate/bicarbonate ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 263 Score = 117 bits (292), Expect = 2e-28, Method: Compositional matrix adjust. Identities = 59/89 (66%), Positives = 70/89 (78%), Gaps = 2/89 (2%) Query: 1 MDEPFAALDALTRRKMQEELLILWEEVRFTLLFVTHSIEEALVVGNRILLLSPHPGRVRA 60 MDEPFAALDALTRRKMQ+ELL LW++ +FT+LFVTHSIEEA+ VG RILLL+PHPG+VRA Sbjct: 174 MDEPFAALDALTRRKMQDELLRLWDDTQFTVLFVTHSIEEAIRVGTRILLLTPHPGQVRA 233 Query: 61 EINSHQYDLQSLGGVGFQETARRIHRLLF 89 E+NS D LG E RI+ +LF Sbjct: 234 ELNS--IDPSQLGTAAQAELETRINDMLF 260 >gi|300309717|ref|YP_003773809.1| nitrate/sulfonate/bicarbonate ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 269 Score = 81.6 bits (200), Expect = 1e-17, Method: Compositional matrix adjust. Identities = 40/91 (43%), Positives = 61/91 (67%) Query: 1 MDEPFAALDALTRRKMQEELLILWEEVRFTLLFVTHSIEEALVVGNRILLLSPHPGRVRA 60 MDEPF ALDALTRR +Q+ELL +W+E R T++FVTHSIEEA+ + +RI++++ PG V+ Sbjct: 164 MDEPFGALDALTRRNLQDELLRIWDEFRKTIVFVTHSIEEAIYLADRIVVMTYRPGTVKR 223 Query: 61 EINSHQYDLQSLGGVGFQETARRIHRLLFNE 91 ++ + L+ F R + +L+ E Sbjct: 224 DMLVNLPRLRDPADPEFNALKRELGQLVMEE 254 >gi|300311645|ref|YP_003775737.1| taurine ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 261 Score = 73.2 bits (178), Expect = 4e-15, Method: Compositional matrix adjust. Identities = 31/64 (48%), Positives = 45/64 (70%) Query: 1 MDEPFAALDALTRRKMQEELLILWEEVRFTLLFVTHSIEEALVVGNRILLLSPHPGRVRA 60 MDEPF ALD++TR +MQE L+ +W + F+THSIEEAL +G ++++SP PGR+ A Sbjct: 157 MDEPFGALDSMTREQMQELLVSVWARTGKQVFFITHSIEEALFLGTEVIVMSPRPGRIVA 216 Query: 61 EINS 64 + Sbjct: 217 RFET 220 >gi|300309802|ref|YP_003773894.1| nitrate/sulfonate/bicarbonate ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 278 Score = 65.1 bits (157), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 28/62 (45%), Positives = 43/62 (69%) Query: 1 MDEPFAALDALTRRKMQEELLILWEEVRFTLLFVTHSIEEALVVGNRILLLSPHPGRVRA 60 MDEPF ALD TR K+ +L +W T++FVTHSI EA+ + +R+++++ PGRV A Sbjct: 174 MDEPFGALDEFTRNKLDADLRDIWSRQDLTVVFVTHSIYEAVFLSSRVIVMAARPGRVIA 233 Query: 61 EI 62 ++ Sbjct: 234 DV 235 Database: BlastDatabases/689/689 Posted date: Apr 10, 2011 12:15 AM Number of letters in database: 1,619,870 Number of sequences in database: 4735 Lambda K H 0.324 0.140 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 4735 Number of Hits to DB: 340,911 Number of extensions: 12145 Number of successful extensions: 98 Number of sequences better than 1.0e-08: 13 Number of HSP's gapped: 97 Number of HSP's successfully gapped: 13 Length of query: 108 Length of database: 1,619,870 Length adjustment: 72 Effective length of query: 36 Effective length of database: 1,278,950 Effective search space: 46042200 Effective search space used: 46042200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 124 (52.4 bits)