BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0099.0016.p (153 letters) Database: BlastDatabases/689/689 4735 sequences; 1,619,870 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|300312564|ref|YP_003776656.1| outer membrane multidrug resist... 198 1e-52 gi|300312015|ref|YP_003776107.1| NodT family protein [Herbaspiri... 63 1e-11 gi|300312742|ref|YP_003776834.1| outer membrane efflux protein [... 56 1e-09 >gi|300312564|ref|YP_003776656.1| outer membrane multidrug resistance lipoprotein [Herbaspirillum seropedicae SmR1] Length = 515 Score = 198 bits (504), Expect = 1e-52, Method: Compositional matrix adjust. Identities = 97/121 (80%), Positives = 109/121 (90%) Query: 1 LLKAEGVAQQQGAALLPQVTGNASLDHMKQSYNNGVPADFVPRGYNNEARVTLDFSYEID 60 L+KAEG AQQQGAAL PQV+ NASLD MKQSYNNGVP DFVP+ YNN R TLDFSYEID Sbjct: 109 LMKAEGAAQQQGAALYPQVSANASLDRMKQSYNNGVPPDFVPKDYNNATRATLDFSYEID 168 Query: 61 FWGKNRAALAAATSELEAARADAAQARITLATSIAAGYAELERLFSQRDTSQAALQVRQE 120 FWGKNRAALAAATSELEA+RADAAQARITLATSIA+ YAEL +L++QRDT++AAL+VR E Sbjct: 169 FWGKNRAALAAATSELEASRADAAQARITLATSIASAYAELAQLYAQRDTNEAALKVRVE 228 Query: 121 T 121 + Sbjct: 229 S 229 >gi|300312015|ref|YP_003776107.1| NodT family protein [Herbaspirillum seropedicae SmR1] Length = 495 Score = 62.8 bits (151), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 40/115 (34%), Positives = 59/115 (51%), Gaps = 1/115 (0%) Query: 9 QQQGAALLPQVTGNASLDHMKQSYNNGVPADFVPRGYNNEARVTLDFSYEIDFWGKNRAA 68 + +GA LLP V AS+ + S P + YN E + L+ YE+D W KN+AA Sbjct: 108 ESRGAPLLPSVNAEASVTRNQFSSTTIYPPPYGGNWYN-EKKAGLNVGYELDLWNKNQAA 166 Query: 69 LAAATSELEAARADAAQARITLATSIAAGYAELERLFSQRDTSQAALQVRQETEN 123 LA A S +AA+A +AR+ L SI Y++L ++ D Q+ + R E Sbjct: 167 LAQAISSEKAAQASEQEARLALTASIVTVYSQLAAQYALHDILQSTVDQRTSLEK 221 >gi|300312742|ref|YP_003776834.1| outer membrane efflux protein [Herbaspirillum seropedicae SmR1] Length = 492 Score = 55.8 bits (133), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 45/130 (34%), Positives = 62/130 (47%), Gaps = 13/130 (10%) Query: 3 KAEGVAQQQGAALLPQVTGNASLDHMKQSYNNGVPADFVPRGYNNEARVTLDFSYEIDFW 62 +AE A+ GA LLP NA + + G P N A +L SYEIDFW Sbjct: 106 QAEAQARIAGAPLLPSAGINAGAAR-EIPISGGTP--------TNTANASLQVSYEIDFW 156 Query: 63 GKNRAALAAATSELEAARADAAQARITLATSIAAGYAEL----ERLFSQRDTSQAALQVR 118 GKNRA + AA + L A R D +T+ + I + Y ++ +RL R Q A +V Sbjct: 157 GKNRAGVEAAEATLRANRYDRETVALTVTSGIVSTYLQVLSLRDRLAIARQNVQNAERVL 216 Query: 119 QETENXSQAA 128 + E S+A Sbjct: 217 RLVEAQSRAG 226 Database: BlastDatabases/689/689 Posted date: Apr 10, 2011 12:15 AM Number of letters in database: 1,619,870 Number of sequences in database: 4735 Lambda K H 0.315 0.128 0.355 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 4735 Number of Hits to DB: 365,890 Number of extensions: 10562 Number of successful extensions: 47 Number of sequences better than 1.0e-08: 3 Number of HSP's gapped: 46 Number of HSP's successfully gapped: 3 Length of query: 153 Length of database: 1,619,870 Length adjustment: 77 Effective length of query: 76 Effective length of database: 1,255,275 Effective search space: 95400900 Effective search space used: 95400900 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 126 (53.1 bits)