BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0095.0009.p (112 letters) Database: BlastDatabases/689/689 4735 sequences; 1,619,870 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|300312716|ref|YP_003776808.1| ABC transporter duplicated ATPa... 131 1e-32 gi|300312478|ref|YP_003776570.1| dipeptide/oligopeptide/nickel A... 84 3e-18 gi|300310895|ref|YP_003774987.1| dipeptide/oligopeptide/nickel A... 82 8e-18 gi|300310466|ref|YP_003774558.1| dipeptide/oligopeptide/nickel A... 82 1e-17 gi|300312477|ref|YP_003776569.1| oligopeptide ABC transporter AT... 82 1e-17 >gi|300312716|ref|YP_003776808.1| ABC transporter duplicated ATPase [Herbaspirillum seropedicae SmR1] Length = 529 Score = 131 bits (329), Expect = 1e-32, Method: Compositional matrix adjust. Identities = 62/76 (81%), Positives = 72/76 (94%) Query: 18 EPTSALDVTVQQQVLQLLAQLQRKHGLAYLFISHDLAVIRAMAHQVLVMKDGKVVESGAV 77 EPTSALDVTVQQQVLQLLA+LQR+HGLAYLFI+HDLAV++AMAHQV+VMKDGKVVESGA Sbjct: 444 EPTSALDVTVQQQVLQLLAELQRRHGLAYLFITHDLAVVQAMAHQVIVMKDGKVVESGAT 503 Query: 78 SEVLQQPSHAYTQRLL 93 ++VLQQP YT+RL+ Sbjct: 504 AQVLQQPQQEYTRRLV 519 Score = 84.7 bits (208), Expect = 2e-18, Method: Compositional matrix adjust. Identities = 41/76 (53%), Positives = 56/76 (73%) Query: 18 EPTSALDVTVQQQVLQLLAQLQRKHGLAYLFISHDLAVIRAMAHQVLVMKDGKVVESGAV 77 EPT+ALDVT+Q Q+L LL QLQR+ +A L ISHDL ++R A +V VM+ GK+VES +V Sbjct: 175 EPTTALDVTIQVQILALLNQLQREENMAVLIISHDLNLVRHFADRVGVMEKGKLVESASV 234 Query: 78 SEVLQQPSHAYTQRLL 93 +E+ P YT++LL Sbjct: 235 AELFANPQQPYTRKLL 250 >gi|300312478|ref|YP_003776570.1| dipeptide/oligopeptide/nickel ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 334 Score = 83.6 bits (205), Expect = 3e-18, Method: Compositional matrix adjust. Identities = 40/87 (45%), Positives = 59/87 (67%) Query: 18 EPTSALDVTVQQQVLQLLAQLQRKHGLAYLFISHDLAVIRAMAHQVLVMKDGKVVESGAV 77 EPT+ALDVT+Q Q+L+++ +LQ++ G A +FI+HDL V+ +A +V VM G+VVE+ V Sbjct: 180 EPTTALDVTIQAQILRMIRELQQEFGAAVIFITHDLGVVSRIADRVAVMYAGQVVETTDV 239 Query: 78 SEVLQQPSHAYTQRLLAAATYAADELP 104 +++ QP H YTQ LL LP Sbjct: 240 AQLFAQPRHPYTQGLLNCIPVRGKTLP 266 >gi|300310895|ref|YP_003774987.1| dipeptide/oligopeptide/nickel ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 330 Score = 82.4 bits (202), Expect = 8e-18, Method: Compositional matrix adjust. Identities = 38/78 (48%), Positives = 56/78 (71%) Query: 18 EPTSALDVTVQQQVLQLLAQLQRKHGLAYLFISHDLAVIRAMAHQVLVMKDGKVVESGAV 77 EPT+ALDVT+Q Q+L + +L R+HG A ++I+HDL+V+ +A +V VM G++VE G+V Sbjct: 181 EPTTALDVTIQAQILSEVQKLARQHGTALIWITHDLSVVAGLADEVAVMYAGRIVEQGSV 240 Query: 78 SEVLQQPSHAYTQRLLAA 95 VL P H YTQ L+ + Sbjct: 241 DAVLDAPLHPYTQGLIGS 258 >gi|300310466|ref|YP_003774558.1| dipeptide/oligopeptide/nickel ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 645 Score = 81.6 bits (200), Expect = 1e-17, Method: Compositional matrix adjust. Identities = 40/83 (48%), Positives = 61/83 (73%) Query: 18 EPTSALDVTVQQQVLQLLAQLQRKHGLAYLFISHDLAVIRAMAHQVLVMKDGKVVESGAV 77 EPT+ALDVT Q +VL+ + ++ G +++SHDLAV+ MA +++V++DG V E+G+ Sbjct: 205 EPTTALDVTTQIEVLRAFKNVVKELGTTAVYVSHDLAVVAQMADRIIVLRDGAVRETGST 264 Query: 78 SEVLQQPSHAYTQRLLAAATYAA 100 S+VL P+ +YTQ LLAAA+ AA Sbjct: 265 SQVLHAPADSYTQCLLAAASPAA 287 Score = 61.6 bits (148), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 29/78 (37%), Positives = 52/78 (66%) Query: 18 EPTSALDVTVQQQVLQLLAQLQRKHGLAYLFISHDLAVIRAMAHQVLVMKDGKVVESGAV 77 E TSALD V +L+LLA+L+R+ ++Y+FISHD++ +RA+ ++V+ G++V + Sbjct: 481 EVTSALDTVVAAAILELLAELRRELQVSYMFISHDISTVRAICDDIVVLYAGRMVANRPR 540 Query: 78 SEVLQQPSHAYTQRLLAA 95 ++ P H Y+ LL++ Sbjct: 541 EAMMAPPYHPYSHLLLSS 558 >gi|300312477|ref|YP_003776569.1| oligopeptide ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 280 Score = 81.6 bits (200), Expect = 1e-17, Method: Compositional matrix adjust. Identities = 40/79 (50%), Positives = 54/79 (68%) Query: 18 EPTSALDVTVQQQVLQLLAQLQRKHGLAYLFISHDLAVIRAMAHQVLVMKDGKVVESGAV 77 EPTSALDV+VQ Q+L LL L+ + GL YLFISHDL V+ + +V VM G +VE + Sbjct: 187 EPTSALDVSVQAQILNLLLDLKAEFGLTYLFISHDLGVVEHLVDRVAVMNQGSIVELQSR 246 Query: 78 SEVLQQPSHAYTQRLLAAA 96 ++ +P H YT+ LLA+A Sbjct: 247 EQLFSEPQHLYTRMLLASA 265 Database: BlastDatabases/689/689 Posted date: Apr 10, 2011 12:15 AM Number of letters in database: 1,619,870 Number of sequences in database: 4735 Lambda K H 0.316 0.125 0.330 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 4735 Number of Hits to DB: 261,508 Number of extensions: 7176 Number of successful extensions: 131 Number of sequences better than 1.0e-08: 13 Number of HSP's gapped: 146 Number of HSP's successfully gapped: 16 Length of query: 112 Length of database: 1,619,870 Length adjustment: 73 Effective length of query: 39 Effective length of database: 1,274,215 Effective search space: 49694385 Effective search space used: 49694385 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 124 (52.4 bits)