BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0092.0054.p
         (108 letters)

Database: BlastDatabases/689/689 
           4735 sequences; 1,619,870 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|300311253|ref|YP_003775345.1| RNA polymerase sigma-E factor (...   126   3e-31

>gi|300311253|ref|YP_003775345.1| RNA polymerase sigma-E factor
          (sigma-24) transcription regulator protein
          [Herbaspirillum seropedicae SmR1]
          Length = 200

 Score =  126 bits (317), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 64/67 (95%), Positives = 65/67 (97%)

Query: 19 LTTEREIDQLLVERVQRGDKKAFELLVAKYQRKLMRLVSRLVRDQAEAEDVVQEAFIKAY 78
          +TTEREIDQ LVERVQRGDKKAFELLV KYQRKLMRLVSRLVRDQAEAEDVVQEAFIKAY
Sbjct: 1  MTTEREIDQQLVERVQRGDKKAFELLVVKYQRKLMRLVSRLVRDQAEAEDVVQEAFIKAY 60

Query: 79 RALPQFR 85
          RALPQFR
Sbjct: 61 RALPQFR 67


  Database: BlastDatabases/689/689
    Posted date:  Apr 10, 2011 12:15 AM
  Number of letters in database: 1,619,870
  Number of sequences in database:  4735
  
Lambda     K      H
   0.325    0.135    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 4735
Number of Hits to DB: 288,674
Number of extensions: 8583
Number of successful extensions: 51
Number of sequences better than 1.0e-08: 1
Number of HSP's gapped: 51
Number of HSP's successfully gapped: 1
Length of query: 108
Length of database: 1,619,870
Length adjustment: 72
Effective length of query: 36
Effective length of database: 1,278,950
Effective search space: 46042200
Effective search space used: 46042200
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 124 (52.4 bits)