BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0058.0017.p (141 letters) Database: BlastDatabases/689/689 4735 sequences; 1,619,870 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|300311645|ref|YP_003775737.1| taurine ABC transporter ATPase ... 116 5e-28 gi|300309802|ref|YP_003773894.1| nitrate/sulfonate/bicarbonate A... 108 1e-25 gi|300309717|ref|YP_003773809.1| nitrate/sulfonate/bicarbonate A... 107 2e-25 gi|300310818|ref|YP_003774910.1| nitrate/sulfonate/bicarbonate A... 103 5e-24 gi|300313547|ref|YP_003777639.1| nitrate/sulfonate/bicarbonate A... 102 1e-23 >gi|300311645|ref|YP_003775737.1| taurine ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 261 Score = 116 bits (291), Expect = 5e-28, Method: Compositional matrix adjust. Identities = 55/94 (58%), Positives = 68/94 (72%) Query: 17 AGAXELSGGMQQRVAIARSLIHDPSILMMDEPFGALDAMTREVMNLELLRIWRKAGKTVI 76 A ELSGGM+QRV +AR+L +P IL+MDEPFGALD+MTRE M L+ +W + GK V Sbjct: 129 AAPYELSGGMRQRVGLARALAPNPKILLMDEPFGALDSMTREQMQELLVSVWARTGKQVF 188 Query: 77 FVTHSIPEAIFLGTHVMVLSNRPGRIADLVTVDL 110 F+THSI EA+FLGT V+V+S RPGRI D Sbjct: 189 FITHSIEEALFLGTEVIVMSPRPGRIVARFETDF 222 >gi|300309802|ref|YP_003773894.1| nitrate/sulfonate/bicarbonate ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 278 Score = 108 bits (271), Expect = 1e-25, Method: Compositional matrix adjust. Identities = 58/131 (44%), Positives = 79/131 (60%), Gaps = 3/131 (2%) Query: 12 ETENAAGAXELSGGMQQRVAIARSLIHDPSILMMDEPFGALDAMTREVMNLELLRIWRKA 71 E+ +A ELSGGMQ R +IAR+L P++L+MDEPFGALD TR ++ +L IW + Sbjct: 141 ESFHAVLPRELSGGMQMRASIARALATSPNLLLMDEPFGALDEFTRNKLDADLRDIWSRQ 200 Query: 72 GKTVIFVTHSIPEAIFLGTHVMVLSNRPGRIADLVTVDLPAERSLDIMSTDAFGVYSKRI 131 TV+FVTHSI EA+FL + V+V++ RPGR+ V +D P R + F Y K + Sbjct: 201 DLTVVFVTHSIYEAVFLSSRVIVMAARPGRVIADVAIDAPGPRDEAFRMSAPFMQYCKTL 260 Query: 132 RSQF---NTQG 139 N QG Sbjct: 261 SDYLTLANQQG 271 >gi|300309717|ref|YP_003773809.1| nitrate/sulfonate/bicarbonate ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 269 Score = 107 bits (268), Expect = 2e-25, Method: Compositional matrix adjust. Identities = 53/95 (55%), Positives = 70/95 (73%) Query: 21 ELSGGMQQRVAIARSLIHDPSILMMDEPFGALDAMTREVMNLELLRIWRKAGKTVIFVTH 80 +LSGGM+QRVAIAR L D I++MDEPFGALDA+TR + ELLRIW + KT++FVTH Sbjct: 140 DLSGGMRQRVAIARVLALDSPIMLMDEPFGALDALTRRNLQDELLRIWDEFRKTIVFVTH 199 Query: 81 SIPEAIFLGTHVMVLSNRPGRIADLVTVDLPAERS 115 SI EAI+L ++V++ RPG + + V+LP R Sbjct: 200 SIEEAIYLADRIVVMTYRPGTVKRDMLVNLPRLRD 234 >gi|300310818|ref|YP_003774910.1| nitrate/sulfonate/bicarbonate ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 265 Score = 103 bits (258), Expect = 5e-24, Method: Compositional matrix adjust. Identities = 56/119 (47%), Positives = 74/119 (62%), Gaps = 4/119 (3%) Query: 21 ELSGGMQQRVAIARSLIHDPSILMMDEPFGALDAMTREVMNLELLRIWRKAGKTVIFVTH 80 ELSGGM+QR IAR L+++PS+++MDEPFGALDA TREV+ EL RIW+ G T++FVTH Sbjct: 133 ELSGGMRQRAQIARVLVNEPSVVLMDEPFGALDAQTREVLQSELDRIWKSTGCTIVFVTH 192 Query: 81 SIPEAIFLGTHVMVLSNRP-GRIADLVTVDLPAERSLDIMSTDAFGVYSKRIRSQFNTQ 138 I EAI L V+ ++ P I + V LP R D +Y+ RIR + Sbjct: 193 DIWEAILLADRVVTMTAGPRAHIKTIEEVHLPHPR--DPADPACMALYA-RIRDDIGAE 248 >gi|300313547|ref|YP_003777639.1| nitrate/sulfonate/bicarbonate ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 261 Score = 102 bits (255), Expect = 1e-23, Method: Compositional matrix adjust. Identities = 52/114 (45%), Positives = 67/114 (58%) Query: 21 ELSGGMQQRVAIARSLIHDPSILMMDEPFGALDAMTREVMNLELLRIWRKAGKTVIFVTH 80 +LSGGMQQR +I R+LIH+P +L++DEPFGALDA TRE + L +W + VI VTH Sbjct: 141 QLSGGMQQRASICRALIHEPKMLLLDEPFGALDAFTREELWCVLRDLWAERRFNVILVTH 200 Query: 81 SIPEAIFLGTHVMVLSNRPGRIADLVTVDLPAERSLDIMSTDAFGVYSKRIRSQ 134 + EA FL + V+S RPGRI LP L+ TD F +R Sbjct: 201 DLREAAFLADTIYVMSKRPGRIVVRRENPLPRPCPLETTYTDGFNALVHELREH 254 Database: BlastDatabases/689/689 Posted date: Apr 10, 2011 12:15 AM Number of letters in database: 1,619,870 Number of sequences in database: 4735 Lambda K H 0.322 0.135 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 4735 Number of Hits to DB: 400,179 Number of extensions: 14117 Number of successful extensions: 208 Number of sequences better than 1.0e-08: 46 Number of HSP's gapped: 229 Number of HSP's successfully gapped: 46 Length of query: 141 Length of database: 1,619,870 Length adjustment: 76 Effective length of query: 65 Effective length of database: 1,260,010 Effective search space: 81900650 Effective search space used: 81900650 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 126 (53.1 bits)