BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0056.0001.p
         (139 letters)

Database: BlastDatabases/689/689 
           4735 sequences; 1,619,870 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|300311992|ref|YP_003776084.1| phosphoribosyl-dephospho-CoA tr...    65   2e-12

>gi|300311992|ref|YP_003776084.1| phosphoribosyl-dephospho-CoA
           transferase [Herbaspirillum seropedicae SmR1]
          Length = 237

 Score = 65.5 bits (158), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 45/69 (65%)

Query: 18  WRDDLRVMHDQIAAQGLTIRVYGSLALQALTGLSYLRPASDIDVLFSPQDRLQLEHGVSL 77
           W+  +  +  Q+ A G+ + V+GSL+ QA+T  +Y+R +SDID+LF+P  + QL  G+ L
Sbjct: 107 WQAGMEALQQQMQAAGIALAVFGSLSWQAITAQAYVRSSSDIDLLFAPDSQAQLAQGLQL 166

Query: 78  LQRHALRLP 86
           L R A  LP
Sbjct: 167 LARQAAMLP 175


  Database: BlastDatabases/689/689
    Posted date:  Apr 10, 2011 12:15 AM
  Number of letters in database: 1,619,870
  Number of sequences in database:  4735
  
Lambda     K      H
   0.322    0.138    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 4735
Number of Hits to DB: 476,993
Number of extensions: 18888
Number of successful extensions: 61
Number of sequences better than 1.0e-08: 1
Number of HSP's gapped: 61
Number of HSP's successfully gapped: 1
Length of query: 139
Length of database: 1,619,870
Length adjustment: 76
Effective length of query: 63
Effective length of database: 1,260,010
Effective search space: 79380630
Effective search space used: 79380630
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 126 (53.1 bits)