BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0045.0027.p
         (145 letters)

Database: BlastDatabases/689/689 
           4735 sequences; 1,619,870 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|300310320|ref|YP_003774412.1| membrane-bound lytic peptidogly...   100   4e-23

>gi|300310320|ref|YP_003774412.1| membrane-bound lytic peptidoglycan
           transglycosylase B protein [Herbaspirillum seropedicae
           SmR1]
          Length = 369

 Score =  100 bits (249), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 44/71 (61%), Positives = 56/71 (78%)

Query: 50  KKKAAPAEDGEFANFSQWKEVNDFIDEMVARNGFDKAALQALFNKARYIDTAIQLIKPAP 109
           KKK +P + GEF NF++WKEV  F+D+MV RN F ++ L +LF + RY+D+AIQLIKPAP
Sbjct: 43  KKKTSPEDQGEFVNFNEWKEVARFMDDMVERNHFSRSELNSLFAQTRYLDSAIQLIKPAP 102

Query: 110 SGKPKNWQAYR 120
           S KPKNW AYR
Sbjct: 103 SNKPKNWFAYR 113


  Database: BlastDatabases/689/689
    Posted date:  Apr 10, 2011 12:15 AM
  Number of letters in database: 1,619,870
  Number of sequences in database:  4735
  
Lambda     K      H
   0.317    0.130    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 4735
Number of Hits to DB: 389,940
Number of extensions: 13585
Number of successful extensions: 27
Number of sequences better than 1.0e-08: 1
Number of HSP's gapped: 27
Number of HSP's successfully gapped: 1
Length of query: 145
Length of database: 1,619,870
Length adjustment: 77
Effective length of query: 68
Effective length of database: 1,255,275
Effective search space: 85358700
Effective search space used: 85358700
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 126 (53.1 bits)