BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0025.0051.p (106 letters) Database: BlastDatabases/689/689 4735 sequences; 1,619,870 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|300313365|ref|YP_003777457.1| organic solvents resistance ABC... 176 3e-46 gi|300312193|ref|YP_003776285.1| organic solvents resistance ABC... 79 7e-17 gi|300311638|ref|YP_003775730.1| metal ion ABC transporter ATPas... 70 4e-14 gi|300310327|ref|YP_003774419.1| metal ion ABC transporter ATPas... 65 8e-13 gi|300310986|ref|YP_003775078.1| sulfate/molybdate ABC transport... 65 1e-12 >gi|300313365|ref|YP_003777457.1| organic solvents resistance ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 243 Score = 176 bits (446), Expect = 3e-46, Method: Compositional matrix adjust. Identities = 89/105 (84%), Positives = 93/105 (88%) Query: 1 VIAVMGGSGSGKTTILRLIGGQLRPQSGTLTVDGENVPSLDTGDLYRLRRKMGMLFQNGA 60 V+AVMGGSGSGKTTILRLIGGQLRPQ G + VDGENVP L T L+ LRRKMGMLFQNGA Sbjct: 8 VVAVMGGSGSGKTTILRLIGGQLRPQQGKVEVDGENVPDLATKQLFLLRRKMGMLFQNGA 67 Query: 61 LFTDMTVFDNVAFPLHEHTDLPEELIRDLVLLKLNAVGLRNAAPL 105 LFTDMTVFDNVAFPL EHTDL E LIRDLVL+KLNAVGLRNAA L Sbjct: 68 LFTDMTVFDNVAFPLREHTDLDETLIRDLVLMKLNAVGLRNAASL 112 >gi|300312193|ref|YP_003776285.1| organic solvents resistance ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 278 Score = 79.0 bits (193), Expect = 7e-17, Method: Compositional matrix adjust. Identities = 42/103 (40%), Positives = 65/103 (63%) Query: 1 VIAVMGGSGSGKTTILRLIGGQLRPQSGTLTVDGENVPSLDTGDLYRLRRKMGMLFQNGA 60 ++ V+GGSG+GK+ +LR I G LRP +G + V G+++ +L + R+ G+LFQ GA Sbjct: 47 ILGVVGGSGTGKSVLLRSIVGLLRPAAGEVRVFGQDLTALSSEARSGYERRFGVLFQQGA 106 Query: 61 LFTDMTVFDNVAFPLHEHTDLPEELIRDLVLLKLNAVGLRNAA 103 LF+ +TV +N+A PL E+ L + R + +KL GL AA Sbjct: 107 LFSSLTVLENIALPLTEYGGLNADEARGVAAMKLALAGLPIAA 149 >gi|300311638|ref|YP_003775730.1| metal ion ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 389 Score = 69.7 bits (169), Expect = 4e-14, Method: Compositional matrix adjust. Identities = 41/103 (39%), Positives = 60/103 (58%), Gaps = 1/103 (0%) Query: 1 VIAVMGGSGSGKTTILRLIGGQLRPQSGTLTVDGENVPSLDTGDLYRLRRKMGMLFQNGA 60 + ++G SG+GK+++LR I RP SG + VD ++ +LD L LRR++GM+FQ+ Sbjct: 70 IFGIIGRSGAGKSSLLRTINRLERPTSGRVEVDDVDLATLDETQLVALRRRIGMIFQHFN 129 Query: 61 LFTDMTVFDNVAFPLHEHTDLPEELIRDLVLLKLNAVGLRNAA 103 L TVFDN+A PL +P I V L VGL++ A Sbjct: 130 LLAAKTVFDNIALPLRV-AGVPRAQITQRVHELLALVGLQDKA 171 >gi|300310327|ref|YP_003774419.1| metal ion ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 345 Score = 65.5 bits (158), Expect = 8e-13, Method: Compositional matrix adjust. Identities = 29/76 (38%), Positives = 49/76 (64%) Query: 1 VIAVMGGSGSGKTTILRLIGGQLRPQSGTLTVDGENVPSLDTGDLYRLRRKMGMLFQNGA 60 + ++G SG+GK+T++R + RP SG + +DG+++ SL L RR +GM+FQ+ Sbjct: 29 IFGIIGRSGAGKSTLVRTLNLLNRPTSGRIVLDGQDLTSLSAAQLREARRGIGMIFQHFN 88 Query: 61 LFTDMTVFDNVAFPLH 76 L + +V+DN+A PL Sbjct: 89 LLSSRSVYDNIALPLE 104 >gi|300310986|ref|YP_003775078.1| sulfate/molybdate ABC transporter ATPase [Herbaspirillum seropedicae SmR1] Length = 359 Score = 65.1 bits (157), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 34/73 (46%), Positives = 47/73 (64%), Gaps = 5/73 (6%) Query: 3 AVMGGSGSGKTTILRLIGGQLRPQSGTLTVDGENVPSLDTGDLYRLRRKMGMLFQNGALF 62 A++G SG GKTT+LR+I G P SG + +DGE D + R++G +FQ+ ALF Sbjct: 32 ALLGPSGCGKTTLLRIIAGLESPDSGQVLLDGE-----DASARHVRERQVGFVFQHYALF 86 Query: 63 TDMTVFDNVAFPL 75 MTVF+N+AF L Sbjct: 87 KHMTVFENIAFGL 99 Database: BlastDatabases/689/689 Posted date: Apr 10, 2011 12:15 AM Number of letters in database: 1,619,870 Number of sequences in database: 4735 Lambda K H 0.321 0.141 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 4735 Number of Hits to DB: 361,907 Number of extensions: 14775 Number of successful extensions: 258 Number of sequences better than 1.0e-08: 31 Number of HSP's gapped: 274 Number of HSP's successfully gapped: 31 Length of query: 106 Length of database: 1,619,870 Length adjustment: 72 Effective length of query: 34 Effective length of database: 1,278,950 Effective search space: 43484300 Effective search space used: 43484300 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 123 (52.0 bits)