BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0025.0001.p (150 letters) Database: BlastDatabases/689/689 4735 sequences; 1,619,870 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|300313266|ref|YP_003777358.1| AsnC family transcription regul... 189 8e-50 gi|300311006|ref|YP_003775098.1| transcription regulator protein... 92 1e-20 gi|300312490|ref|YP_003776582.1| transcription regulator protein... 70 6e-14 gi|300312130|ref|YP_003776222.1| glutamate uptake transcription ... 69 2e-13 gi|300311014|ref|YP_003775106.1| leucine-responsive regulatory D... 65 3e-12 >gi|300313266|ref|YP_003777358.1| AsnC family transcription regulator protein [Herbaspirillum seropedicae SmR1] Length = 159 Score = 189 bits (480), Expect = 8e-50, Method: Compositional matrix adjust. Identities = 89/107 (83%), Positives = 99/107 (92%) Query: 38 NEGIISRYVALGNPHLLGLKVNVFIKISLEKQESGTLAQFEEAVSAFDEVMEVYLMTGDE 97 +EGIISRYVAL +PHLLGLKVNVF+K+ LE+Q + LAQFE AVSAFDEVMEVYLMTGDE Sbjct: 45 SEGIISRYVALADPHLLGLKVNVFVKVILERQGAEALAQFETAVSAFDEVMEVYLMTGDE 104 Query: 98 DYLLRLVVPDLQALEHFVLDHLTKIPGIKNIRSSFALKQVKYKTALP 144 DYLLR+VVPDL LEHF++DHLTKIPGIKNIRSSFALKQ+KYKTALP Sbjct: 105 DYLLRIVVPDLLTLEHFIVDHLTKIPGIKNIRSSFALKQIKYKTALP 151 >gi|300311006|ref|YP_003775098.1| transcription regulator protein [Herbaspirillum seropedicae SmR1] Length = 172 Score = 92.4 bits (228), Expect = 1e-20, Method: Compositional matrix adjust. Identities = 47/128 (36%), Positives = 74/128 (57%), Gaps = 1/128 (0%) Query: 19 FGQCAFQESAGINARRPYXNEG-IISRYVALGNPHLLGLKVNVFIKISLEKQESGTLAQF 77 GQ ++ I+ R E +I RY A+ +P ++GL V F ++L++Q F Sbjct: 28 LGQKVHLSTSQISRRVQRLEEAHVIERYTAVLDPAVVGLGVTAFTTVTLDRQGETRGELF 87 Query: 78 EEAVSAFDEVMEVYLMTGDEDYLLRLVVPDLQALEHFVLDHLTKIPGIKNIRSSFALKQV 137 E+AV EV E + +TG+ DY+LR+V PDL A F++ L ++PG+ N++S+ LK+V Sbjct: 88 EKAVETMPEVTECFSVTGEGDYILRIVAPDLAAFSEFMMTRLLRLPGVTNVKSNITLKKV 147 Query: 138 KYKTALPL 145 K LPL Sbjct: 148 KQSHELPL 155 >gi|300312490|ref|YP_003776582.1| transcription regulator protein [Herbaspirillum seropedicae SmR1] Length = 153 Score = 70.5 bits (171), Expect = 6e-14, Method: Compositional matrix adjust. Identities = 38/112 (33%), Positives = 61/112 (54%) Query: 27 SAGINARRPYXNEGIISRYVALGNPHLLGLKVNVFIKISLEKQESGTLAQFEEAVSAFDE 86 +A N + EG + A+ +P LGL V V + + L++ + A+FE+AV Sbjct: 34 TACWNHTKRLMEEGYVKEVRAILDPEKLGLPVLVTVGVVLDRSTPESFAEFEKAVRDIAA 93 Query: 87 VMEVYLMTGDEDYLLRLVVPDLQALEHFVLDHLTKIPGIKNIRSSFALKQVK 138 V E L+ G+ DY ++L V DLQA + L ++PG++ +RS F L +VK Sbjct: 94 VQECLLLAGEFDYWIKLRVKDLQAFNRLHANTLLRLPGVRQLRSFFVLNEVK 145 >gi|300312130|ref|YP_003776222.1| glutamate uptake transcription regulator protein [Herbaspirillum seropedicae SmR1] Length = 154 Score = 68.6 bits (166), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 36/107 (33%), Positives = 63/107 (58%), Gaps = 1/107 (0%) Query: 39 EGIISRYVALGNPHLLGLKVNVFIKISLEKQESGTLAQFEEAVSAFDEVMEVYLMTGDED 98 EG+I R V L + L + V V ++I + + L +F + V+ EV+EV+ M+G D Sbjct: 45 EGVIKRRVVLLDAEKLNVSVTVLVEIKTRQHSASWLKKFRDVVTCIPEVVEVHRMSGHID 104 Query: 99 YLLRLVVPDLQALEHFVLDHLTKIPGIKNIRSSFALKQVKYKTALPL 145 Y+L+++VP++ A + V L + ++ SSF+++ +K TALPL Sbjct: 105 YMLKVMVPNIGAYDS-VYKRLISAVELDDVSSSFSMETLKSTTALPL 150 >gi|300311014|ref|YP_003775106.1| leucine-responsive regulatory DNA-binding transcription regulator protein [Herbaspirillum seropedicae SmR1] Length = 162 Score = 64.7 bits (156), Expect = 3e-12, Method: Compositional matrix adjust. Identities = 37/127 (29%), Positives = 62/127 (48%) Query: 21 QCAFQESAGINARRPYXNEGIISRYVALGNPHLLGLKVNVFIKISLEKQESGTLAQFEEA 80 Q + I R +G+I+ Y A NP LG + VF++I+L + QF Sbjct: 36 QVGLSVTPCIERVRRMERDGVITGYYARVNPESLGATLLVFVEITLNHKSGNMFEQFRRE 95 Query: 81 VSAFDEVMEVYLMTGDEDYLLRLVVPDLQALEHFVLDHLTKIPGIKNIRSSFALKQVKYK 140 V EV E +L++GD DYL++ + + + D L ++PG +S ++++K Sbjct: 96 VLRIPEVQECHLVSGDFDYLIKARIRGMAEYRKLLGDILLQLPGAAQSKSYVVMEEIKET 155 Query: 141 TALPLGN 147 ALPL + Sbjct: 156 LALPLDD 162 Database: BlastDatabases/689/689 Posted date: Apr 10, 2011 12:15 AM Number of letters in database: 1,619,870 Number of sequences in database: 4735 Lambda K H 0.322 0.140 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 4735 Number of Hits to DB: 419,307 Number of extensions: 14837 Number of successful extensions: 54 Number of sequences better than 1.0e-08: 7 Number of HSP's gapped: 55 Number of HSP's successfully gapped: 7 Length of query: 150 Length of database: 1,619,870 Length adjustment: 77 Effective length of query: 73 Effective length of database: 1,255,275 Effective search space: 91635075 Effective search space used: 91635075 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 126 (53.1 bits)