BLASTP 2.2.18 [Mar-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0014.0028.p (223 letters) Database: BlastDatabases/689/689 4735 sequences; 1,619,870 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|300311759|ref|YP_003775851.1| short-chain alcohol dehydrogena... 91 6e-20 gi|300311727|ref|YP_003775819.1| dehydrogenase [Herbaspirillum s... 87 1e-18 gi|300309919|ref|YP_003774011.1| 3-oxoacyl-(acyl-carrier protein... 75 3e-15 gi|300311869|ref|YP_003775961.1| short-chain alcohol dehydrogena... 63 2e-11 gi|300311568|ref|YP_003775660.1| toluenesulfonate Zinc-independe... 63 2e-11 >gi|300311759|ref|YP_003775851.1| short-chain alcohol dehydrogenase [Herbaspirillum seropedicae SmR1] Length = 247 Score = 91.3 bits (225), Expect = 6e-20, Method: Compositional matrix adjust. Identities = 53/130 (40%), Positives = 76/130 (58%), Gaps = 2/130 (1%) Query: 5 PVDVLVNNAGYGHEGILEESGMDALQRQFDVNVFGAVAVTKSFVPFMRQRRRGHIINITS 64 PVDVLVNNAG G+ G LE M ++ F+ N G++A+T++F+P MR R +G +IN+TS Sbjct: 68 PVDVLVNNAGIGNLGALEAQPMAQVRELFETNTLGSIAMTQAFIPQMRARGQGLVINVTS 127 Query: 65 MGGFITMPGIAYYCGSKFALEGISETLGKELRAFNVFVTAVAPG-SFRTDWAGRSMVRSP 123 +P +A Y SK A+ +E+L EL V V V PG S +T +A + R Sbjct: 128 SVTLRALPLLAVYTASKAAINAFTESLALELAPLGVQVRLVLPGRSPQTRFAENARARMA 187 Query: 124 RSIAD-YDAL 132 S+ + Y AL Sbjct: 188 ASVPEPYAAL 197 >gi|300311727|ref|YP_003775819.1| dehydrogenase [Herbaspirillum seropedicae SmR1] Length = 247 Score = 86.7 bits (213), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 44/104 (42%), Positives = 61/104 (58%) Query: 5 PVDVLVNNAGYGHEGILEESGMDALQRQFDVNVFGAVAVTKSFVPFMRQRRRGHIINITS 64 P+DVLVNNAG G G E + M ++ F+ N FG +A+ ++ +P R+R G IIN+TS Sbjct: 68 PIDVLVNNAGIGLFGAFEATPMSTVREIFETNTFGVMAMCQAVIPQFRERGDGVIINVTS 127 Query: 65 MGGFITMPGIAYYCGSKFALEGISETLGKELRAFNVFVTAVAPG 108 P +A Y SK A+EG + +L EL+A V V V PG Sbjct: 128 SATLAAFPLVAAYTASKTAIEGFTASLAHELKAVGVRVKLVEPG 171 >gi|300309919|ref|YP_003774011.1| 3-oxoacyl-(acyl-carrier protein) reductase [Herbaspirillum seropedicae SmR1] Length = 244 Score = 75.5 bits (184), Expect = 3e-15, Method: Compositional matrix adjust. Identities = 40/113 (35%), Positives = 60/113 (53%), Gaps = 1/113 (0%) Query: 6 VDVLVNNAGYGHEGI-LEESGMDALQRQFDVNVFGAVAVTKSFVPFMRQRRRGHIINITS 64 +D L+NNAGY + L+E + R VN+ G +S P MR RRG I+NI S Sbjct: 79 IDFLINNAGYAGPTVPLDEYDVGEWHRIVQVNLLGVFHACRSVTPAMRAARRGRIVNIAS 138 Query: 65 MGGFITMPGIAYYCGSKFALEGISETLGKELRAFNVFVTAVAPGSFRTDWAGR 117 + G P + Y +K + ++++LGKEL V V A+AP + +T G+ Sbjct: 139 LAGKEGTPNASAYSAAKAGVLALTKSLGKELAESGVLVNAIAPAAVKTALLGQ 191 >gi|300311869|ref|YP_003775961.1| short-chain alcohol dehydrogenase [Herbaspirillum seropedicae SmR1] Length = 257 Score = 62.8 bits (151), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 37/108 (34%), Positives = 56/108 (51%), Gaps = 2/108 (1%) Query: 9 LVNNAGYGHEGILEESGMDALQRQFDVNVFGAVAVTKSFVPFMRQRRRGHIINITSMGGF 68 LVNN G G +EE+ F V++ G +T++ +P + Q G IINI+S Sbjct: 96 LVNNGGMGMHASIEETSEAVFDALFKVHLKGPFFLTQALLPLLAQG--GRIINISSGLAR 153 Query: 69 ITMPGIAYYCGSKFALEGISETLGKELRAFNVFVTAVAPGSFRTDWAG 116 ++PG A Y K +E ++ + KE A + V VAPG+ TD+ G Sbjct: 154 FSLPGYAAYASMKGGVEVMTRYMAKEFGARGIVVNTVAPGAIETDFGG 201 >gi|300311568|ref|YP_003775660.1| toluenesulfonate Zinc-independent alcohol dehydrogenase [Herbaspirillum seropedicae SmR1] Length = 252 Score = 62.8 bits (151), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 39/106 (36%), Positives = 53/106 (50%), Gaps = 1/106 (0%) Query: 3 FXPVDVLVNNAGYGHEG-ILEESGMDALQRQFDVNVFGAVAVTKSFVPFMRQRRRGHIIN 61 F +D++VNNAG H + E D R + VNV K+FVP+ RQ G IN Sbjct: 80 FGKLDIVVNNAGTTHRNRPMLEVEEDEFDRVYAVNVKSIFLSAKTFVPYFRQVGGGAFIN 139 Query: 62 ITSMGGFITMPGIAYYCGSKFALEGISETLGKELRAFNVFVTAVAP 107 I S G PG+ +Y GSK A+ S+++ EL + V V P Sbjct: 140 IASTAGIRPRPGLTWYNGSKGAVITTSKSMAAELGPDKIRVNCVNP 185 Database: BlastDatabases/689/689 Posted date: Apr 10, 2011 12:15 AM Number of letters in database: 1,619,870 Number of sequences in database: 4735 Lambda K H 0.323 0.139 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 4735 Number of Hits to DB: 557,666 Number of extensions: 19869 Number of successful extensions: 99 Number of sequences better than 1.0e-08: 15 Number of HSP's gapped: 105 Number of HSP's successfully gapped: 15 Length of query: 223 Length of database: 1,619,870 Length adjustment: 82 Effective length of query: 141 Effective length of database: 1,231,600 Effective search space: 173655600 Effective search space used: 173655600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 129 (54.3 bits)