BLASTP 2.2.18 [Mar-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 0001.0001.p
         (115 letters)

Database: BlastDatabases/689/689 
           4735 sequences; 1,619,870 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|300310937|ref|YP_003775029.1| heavy metal translocating P-typ...    79   8e-17

>gi|300310937|ref|YP_003775029.1| heavy metal translocating P-type
          ATPase [Herbaspirillum seropedicae SmR1]
          Length = 744

 Score = 79.3 bits (194), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 49/65 (75%)

Query: 12 ELTLAVEGMTCASCVGRVEKALRAVPAVQDVSVNLATERATIQAGPDVHADQLIAAVNKA 71
          +++L +EGM+CASCV RVEK L+ +P V +VSVNLATERA+I     V  +QLIAA+ KA
Sbjct: 10 DISLDIEGMSCASCVMRVEKVLKKIPGVTEVSVNLATERASIVTAGAVAPEQLIAAIEKA 69

Query: 72 GYDVR 76
          GY  R
Sbjct: 70 GYHAR 74


  Database: BlastDatabases/689/689
    Posted date:  Apr 10, 2011 12:15 AM
  Number of letters in database: 1,619,870
  Number of sequences in database:  4735
  
Lambda     K      H
   0.318    0.128    0.360 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 4735
Number of Hits to DB: 318,471
Number of extensions: 10892
Number of successful extensions: 52
Number of sequences better than 1.0e-08: 1
Number of HSP's gapped: 52
Number of HSP's successfully gapped: 1
Length of query: 115
Length of database: 1,619,870
Length adjustment: 73
Effective length of query: 42
Effective length of database: 1,274,215
Effective search space: 53517030
Effective search space used: 53517030
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 124 (52.4 bits)