BLASTP 2.2.21 [Jun-14-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0232.0003.p (184 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,459,386 sequences; 5,307,515,862 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_443841.1| hypothetical 11.1 kDa protein [Sinorhizobium fr... 147 8e-34 ref|YP_001672182.1| yecA family protein [Caulobacter sp. K31] >g... 80 9e-14 ref|ZP_05934673.1| predicted protein [Brucella ceti B1/94] >gi|2... 80 1e-13 ref|ZP_05993975.1| predicted protein [Brucella suis bv. 5 str. 5... 80 2e-13 ref|NP_541693.1| preprotein translocase subunit-like protein [Br... 80 2e-13 >ref|NP_443841.1| hypothetical 11.1 kDa protein [Sinorhizobium fredii NGR234] sp|P55432.1|Y4EI_RHISN RecName: Full=Uncharacterized protein y4eI gb|AAB91653.1| hypothetical 11.1 kDa protein [Sinorhizobium fredii NGR234] Length = 103 Score = 147 bits (371), Expect = 8e-34, Method: Compositional matrix adjust. Identities = 73/86 (84%), Positives = 76/86 (88%) Query: 1 MPLTELERWLQARANRHPVATSIAMLDGYAAAIVAGPVSMSPLDWICPLLAIDADAFNHG 60 MPL ELERWLQAR +R P+ATS+AMLDGY AAIVAGPVSMSPLDWICPLLAIDADAFNHG Sbjct: 6 MPLEELERWLQARVDRQPIATSLAMLDGYVAAIVAGPVSMSPLDWICPLLAIDADAFNHG 65 Query: 61 GTPEFAAIPAVALRHNDISNTLSTAP 86 TPEFAAI AVALRHNDISN L P Sbjct: 66 DTPEFAAIFAVALRHNDISNVLRPRP 91 >ref|YP_001672182.1| yecA family protein [Caulobacter sp. K31] gb|ABZ74523.1| yecA family protein [Caulobacter sp. K31] Length = 192 Score = 80.5 bits (197), Expect = 9e-14, Method: Compositional matrix adjust. Identities = 45/127 (35%), Positives = 72/127 (56%), Gaps = 4/127 (3%) Query: 1 MPLTELERWLQARANRHPVATS-IAMLDGYAAAIVAGPVSMSPLDWICPLLAIDADAFNH 59 M L LE W + RA + PV T+ ++M+DG+ A +V P + P W+ L+ D + + Sbjct: 1 MTLEALEDWFE-RA-KPPVHTAGVSMMDGFLAGVVISPAFIHPETWLWHLIG-DHEKRAY 57 Query: 60 GGTPEFAAIPAVALRHNDISNTLSTAPDRFEPMHRRDVNGDIDPRPWCQGFYAAMQLRLS 119 GT AA+ A+ +N IS+ L+ AP + P++ R G++ W GFY AM+L ++ Sbjct: 58 AGTKADAAVQAIVAHYNKISDVLANAPHAYAPIYMRTDEGEVLVEDWANGFYGAMRLNMA 117 Query: 120 AWAPLLD 126 AW PL + Sbjct: 118 AWQPLFE 124 >ref|ZP_05934673.1| predicted protein [Brucella ceti B1/94] ref|ZP_06108815.1| predicted protein [Brucella ceti M490/95/1] gb|EEX85629.1| predicted protein [Brucella ceti B1/94] gb|EEZ06716.1| predicted protein [Brucella ceti M490/95/1] Length = 201 Score = 80.1 bits (196), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 55/187 (29%), Positives = 94/187 (50%), Gaps = 10/187 (5%) Query: 1 MPLTELERWLQARANRHPVATSIAMLDGYAAAIVAGPVSMSPLDWICPLLAI-DADAFNH 59 + L +LE W +A P ++ L+G+ + AGPV + P DW+ ++ + AF Sbjct: 10 LTLDQLETWFD-KAEPAPPCRGVSTLNGFLTGLAAGPVFLLPNDWMFHVIGKHEEKAFV- 67 Query: 60 GGTPEFAAIPAVALRHNDISNTLSTAPDRFEPMHRRDVNGDIDPRPWCQGFYAAMQLRLS 119 G +A I + +N I++ L TAP R+ PM R + ++ P W GFY A++L L+ Sbjct: 68 -GNKTYAVIETIVDHYNLIAHQL-TAPGRYAPMFMRTDDEEVLPSDWADGFYGAIKLNLA 125 Query: 120 AWAPLLDAGNGNHGLLLPILLHSRDDQNRPLLGA----PQSGREPNAHADIPAAVEALRQ 175 AWAPL+ A ++ IL+ + + ++ A P +A IP A+E + Sbjct: 126 AWAPLM-AEKQTGDPIMAILMQATEPDLLEMVSAVYPKPPEAILKDAWRAIPTAIETIYA 184 Query: 176 YWMPIRY 182 + P+R+ Sbjct: 185 HCKPMRF 191 >ref|ZP_05993975.1| predicted protein [Brucella suis bv. 5 str. 513] gb|EEY27945.1| predicted protein [Brucella suis bv. 5 str. 513] Length = 201 Score = 79.7 bits (195), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 55/187 (29%), Positives = 94/187 (50%), Gaps = 10/187 (5%) Query: 1 MPLTELERWLQARANRHPVATSIAMLDGYAAAIVAGPVSMSPLDWICPLLAI-DADAFNH 59 + L +LE W +A P ++ L+G+ + AGPV + P DW+ ++ + AF Sbjct: 10 LTLDQLETWFD-KAEPAPPCQGVSTLNGFLTGLAAGPVFLLPNDWMFHVIGKHEEKAFV- 67 Query: 60 GGTPEFAAIPAVALRHNDISNTLSTAPDRFEPMHRRDVNGDIDPRPWCQGFYAAMQLRLS 119 G +A I + +N I++ L TAP R+ PM R + ++ P W GFY A++L L+ Sbjct: 68 -GNKTYAVIETIVDHYNLIAHQL-TAPGRYAPMFMRTDDEEVLPGDWADGFYGAIKLNLA 125 Query: 120 AWAPLLDAGNGNHGLLLPILLHSRDDQNRPLLGA----PQSGREPNAHADIPAAVEALRQ 175 AWAPL+ A ++ IL+ + + ++ A P +A IP A+E + Sbjct: 126 AWAPLM-AEKQTGDPIMAILMQATEPDLLEMVSAVYPKPPEAILKDAWRAIPTAIETIYA 184 Query: 176 YWMPIRY 182 + P+R+ Sbjct: 185 HCKPMRF 191 >ref|NP_541693.1| preprotein translocase subunit-like protein [Brucella melitensis bv. 1 str. 16M] ref|YP_223440.1| IS66 family element, orf4 [Brucella abortus bv. 1 str. 9-941] ref|YP_418860.1| preprotein translocase subunit-like protein [Brucella melitensis biovar Abortus 2308] ref|YP_001932581.1| preprotein translocase subunit-like protein [Brucella abortus S19] ref|YP_002734314.1| yecA family protein [Brucella melitensis ATCC 23457] ref|YP_003105341.1| IS66 family element, orf4 [Brucella microti CCM 4915] ref|ZP_05465051.1| yecA family protein [Brucella melitensis bv. 2 str. 63/9] ref|ZP_05820645.1| yecA family protein [Brucella abortus NCTC 8038] ref|ZP_05835131.1| yecA family protein [Brucella melitensis bv. 1 str. 16M] ref|ZP_05869029.1| predicted protein [Brucella abortus bv. 6 str. 870] ref|ZP_05872460.1| predicted protein [Brucella abortus bv. 4 str. 292] ref|ZP_05876059.1| predicted protein [Brucella abortus bv. 2 str. 86/8/59] ref|ZP_05894112.1| predicted protein [Brucella abortus bv. 9 str. C68] ref|ZP_05930289.1| predicted protein [Brucella abortus bv. 3 str. Tulya] ref|ZP_05931453.1| predicted protein [Brucella ceti M13/05/1] ref|ZP_05957964.1| predicted protein [Brucella pinnipedialis B2/94] ref|ZP_05959240.1| predicted protein [Brucella ceti M644/93/1] ref|ZP_06000471.1| yecA family protein [Brucella sp. F5/99] ref|ZP_06099122.1| predicted protein [Brucella pinnipedialis M292/94/1] ref|ZP_06102425.1| yecA family protein [Brucella melitensis bv. 1 str. Rev.1] ref|ZP_06933329.1| preprotein translocase subunit-like protein [Brucella abortus bv. 5 str. B3196] ref|YP_004757804.1| transposase IS66, orf4 [Brucella pinnipedialis B2/94] gb|AAL53957.1| preprotein translocase subunit-like protein [Brucella melitensis bv. 1 str. 16M] gb|AAX76079.1| hypothetical IS66 family element, orf4 [Brucella abortus bv. 1 str. 9-941] emb|CAJ12851.1| preprotein translocase subunit-like protein [Brucella melitensis biovar Abortus 2308] gb|ACD74135.1| preprotein translocase subunit-like protein [Brucella abortus S19] gb|ACO02360.1| yecA family protein [Brucella melitensis ATCC 23457] gb|ACU49679.1| IS66 family element, orf4, putative [Brucella microti CCM 4915] gb|EEW81969.1| yecA family protein [Brucella abortus NCTC 8038] gb|EEW87382.1| yecA family protein [Brucella melitensis bv. 1 str. 16M] gb|EEX57370.1| predicted protein [Brucella abortus bv. 4 str. 292] gb|EEX60969.1| predicted protein [Brucella abortus bv. 2 str. 86/8/59] gb|EEX63610.1| predicted protein [Brucella abortus bv. 6 str. 870] gb|EEX79095.1| predicted protein [Brucella abortus bv. 9 str. C68] gb|EEX84476.1| predicted protein [Brucella abortus bv. 3 str. Tulya] gb|EEX88829.1| predicted protein [Brucella ceti M13/05/1] gb|EEX96229.1| predicted protein [Brucella ceti M644/93/1] gb|EEY01487.1| predicted protein [Brucella pinnipedialis B2/94] gb|EEY24742.1| yecA family protein [Brucella sp. F5/99] gb|EEZ13227.1| yecA family protein [Brucella melitensis bv. 1 str. Rev.1] gb|EEZ16551.1| yecA family protein [Brucella melitensis bv. 2 str. 63/9] gb|EEZ29023.1| predicted protein [Brucella pinnipedialis M292/94/1] gb|EFH32861.1| preprotein translocase subunit-like protein [Brucella abortus bv. 5 str. B3196] gb|ADZ67774.1| preprotein translocase subunit-like protein [Brucella melitensis M28] gb|ADZ88642.1| preprotein translocase subunit-like protein [Brucella melitensis M5-90] gb|AEK56036.1| transposase IS66, orf4 [Brucella pinnipedialis B2/94] Length = 201 Score = 79.7 bits (195), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 55/187 (29%), Positives = 94/187 (50%), Gaps = 10/187 (5%) Query: 1 MPLTELERWLQARANRHPVATSIAMLDGYAAAIVAGPVSMSPLDWICPLLAI-DADAFNH 59 + L +LE W +A P ++ L+G+ + AGPV + P DW+ ++ + AF Sbjct: 10 LTLDQLETWFD-KAEPAPPCRGVSTLNGFLTGLAAGPVFLLPNDWMFHVIGKHEEKAFV- 67 Query: 60 GGTPEFAAIPAVALRHNDISNTLSTAPDRFEPMHRRDVNGDIDPRPWCQGFYAAMQLRLS 119 G +A I + +N I++ L TAP R+ PM R + ++ P W GFY A++L L+ Sbjct: 68 -GNKTYAVIETIVDHYNLIAHQL-TAPGRYAPMFMRTDDEEVLPGDWADGFYGAIKLNLA 125 Query: 120 AWAPLLDAGNGNHGLLLPILLHSRDDQNRPLLGA----PQSGREPNAHADIPAAVEALRQ 175 AWAPL+ A ++ IL+ + + ++ A P +A IP A+E + Sbjct: 126 AWAPLM-AEKQTGDPIMAILMQATEPDLLEMVSAVYPKPPEAILKDAWRAIPTAIETIYA 184 Query: 176 YWMPIRY 182 + P+R+ Sbjct: 185 HCKPMRF 191