BLASTP 2.2.21 [Jun-14-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0214.0032.p (165 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,459,386 sequences; 5,307,515,862 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|ZP_07031462.1| hypothetical protein AciX8DRAFT_2767 [Acidoba... 143 7e-33 ref|NP_233267.1| hypothetical protein VCA0881 [Vibrio cholerae O... 47 9e-04 ref|YP_004577859.1| hypothetical protein VAA_00244 [Vibrio angui... 47 0.001 ref|ZP_07031460.1| hypothetical protein AciX8DRAFT_2765 [Acidoba... 46 0.002 ref|YP_001508436.1| hypothetical protein Franean1_4144 [Frankia ... 43 0.017 >ref|ZP_07031462.1| hypothetical protein AciX8DRAFT_2767 [Acidobacterium sp. MP5ACTX8] gb|EFI55688.1| hypothetical protein AciX8DRAFT_2767 [Acidobacterium sp. MP5ACTX8] Length = 131 Score = 143 bits (361), Expect = 7e-33, Method: Compositional matrix adjust. Identities = 67/126 (53%), Positives = 90/126 (71%) Query: 5 INILLVVDVVAALEADTLAGSLYMIDDNRPGGSRNQATDGLATAVAPGDEIIWTLLPIEC 64 IN+ ++DVV AL+ +TLAG+ Y+ DDNR GGS NQ T LATAV GD+IIWT+ P+EC Sbjct: 2 INVKSIIDVVGALDDNTLAGNCYLYDDNRRGGSLNQGTHKLATAVKKGDQIIWTVTPMEC 61 Query: 65 ENHAAIRAIKLPPEICEVRRETYPESDVSYWVGTVKQPVGDLPYGLTLELGSRMRTLDNG 124 E +A I AI +P +ICEV+R TY + + YW+GTVK+ V DLPY +TL +GS ++ Sbjct: 62 EAYADITAINVPQDICEVKRYTYDGTAIVYWLGTVKESVDDLPYSITLNVGSHSFSMTCD 121 Query: 125 ADARLI 130 +RLI Sbjct: 122 HGSRLI 127 >ref|NP_233267.1| hypothetical protein VCA0881 [Vibrio cholerae O1 biovar eltor str. N16961] ref|ZP_01676181.1| hypothetical protein VC274080_A0926 [Vibrio cholerae 2740-80] ref|ZP_01679770.1| hypothetical protein VCV52_A0835 [Vibrio cholerae V52] ref|YP_001215198.1| hypothetical protein VC0395_0357 [Vibrio cholerae O395] ref|ZP_01955087.1| hypothetical protein A51_C0808 [Vibrio cholerae MZO-3] ref|ZP_01969719.1| hypothetical protein A5C_A1071 [Vibrio cholerae NCTC 8457] ref|ZP_01975036.1| hypothetical protein A5E_A0897 [Vibrio cholerae B33] ref|ZP_01978085.1| conserved hypothetical protein [Vibrio cholerae MZO-2] ref|YP_002812457.1| hypothetical protein VCM66_A0840 [Vibrio cholerae M66-2] ref|ZP_04395483.1| hypothetical protein VCF_001188 [Vibrio cholerae BX 330286] ref|ZP_04399649.1| hypothetical protein VCE_001571 [Vibrio cholerae B33] ref|ZP_04407145.1| hypothetical protein VCC_001725 [Vibrio cholerae RC9] ref|ZP_04411828.1| hypothetical protein VIF_002967 [Vibrio cholerae TM 11079-80] ref|ZP_04416020.1| hypothetical protein VCA_000746 [Vibrio cholerae bv. albensis VL426] ref|ZP_04417660.1| hypothetical protein VCG_001350 [Vibrio cholerae 12129(1)] ref|YP_002876210.1| hypothetical protein VCD_000452 [Vibrio cholerae MJ-1236] ref|ZP_04959479.1| hypothetical protein A33_A0071 [Vibrio cholerae AM-19226] ref|ZP_05239391.1| conserved hypothetical protein [Vibrio cholerae MO10] ref|ZP_05420320.1| hypothetical protein VCH_002755 [Vibrio cholera CIRS 101] ref|ZP_06036841.1| hypothetical protein VIJ_002362 [Vibrio cholerae RC27] ref|ZP_07009465.1| conserved hypothetical protein [Vibrio cholerae MAK 757] gb|AAF96779.1| hypothetical protein VC_A0881 [Vibrio cholerae O1 biovar El Tor str. N16961] gb|EAX59400.1| hypothetical protein VC274080_A0926 [Vibrio cholerae 2740-80] gb|EAX63478.1| hypothetical protein VCV52_A0835 [Vibrio cholerae V52] gb|EAY42688.1| hypothetical protein A51_C0808 [Vibrio cholerae MZO-3] gb|EAZ75056.1| hypothetical protein A5C_A1071 [Vibrio cholerae NCTC 8457] gb|EAZ77355.1| hypothetical protein A5E_A0897 [Vibrio cholerae B33] gb|ABQ19023.1| hypothetical protein VC0395_0357 [Vibrio cholerae O395] gb|EDM55041.1| conserved hypothetical protein [Vibrio cholerae MZO-2] gb|EDN17073.1| hypothetical protein A33_A0071 [Vibrio cholerae AM-19226] gb|ACP07800.1| conserved hypothetical protein [Vibrio cholerae M66-2] gb|ACP11737.1| conserved hypothetical protein [Vibrio cholerae O395] gb|EEO00117.1| hypothetical protein VCG_001350 [Vibrio cholerae 12129(1)] gb|EEO01792.1| hypothetical protein VCA_000746 [Vibrio cholerae bv. albensis VL426] gb|EEO05403.1| hypothetical protein VIF_002967 [Vibrio cholerae TM 11079-80] gb|EEO10709.1| hypothetical protein VCC_001725 [Vibrio cholerae RC9] gb|EEO17554.1| hypothetical protein VCE_001571 [Vibrio cholerae B33] gb|EEO21243.1| hypothetical protein VCF_001188 [Vibrio cholerae BX 330286] gb|ACQ62414.1| hypothetical protein VCD_000452 [Vibrio cholerae MJ-1236] gb|EET24160.1| conserved hypothetical protein [Vibrio cholerae MO10] gb|EET91525.1| hypothetical protein VCH_002755 [Vibrio cholera CIRS 101] gb|EEY41137.1| hypothetical protein VIJ_002362 [Vibrio cholerae RC27] gb|EFH77691.1| conserved hypothetical protein [Vibrio cholerae MAK 757] gb|EGR05598.1| hypothetical protein VCHC49A2_0809 [Vibrio cholerae HC-49A2] gb|EGS52882.1| hypothetical protein VCHC70A1_3579 [Vibrio cholerae HC-70A1] gb|EGS54252.1| hypothetical protein VCHC48A1_3561 [Vibrio cholerae HC-48A1] gb|EGS54547.1| hypothetical protein VCHC40A1_3542 [Vibrio cholerae HC-40A1] gb|EGS57233.1| hypothetical protein VCHFU02_3376 [Vibrio cholerae HFU-02] gb|EGS67520.1| hypothetical protein VCHC38A1_3550 [Vibrio cholerae HC-38A1] gb|EGS73609.1| hypothetical protein VCBJG01_3467 [Vibrio cholerae BJG-01] Length = 131 Score = 47.0 bits (110), Expect = 9e-04, Method: Compositional matrix adjust. Identities = 25/68 (36%), Positives = 37/68 (54%) Query: 3 KTINILLVVDVVAALEADTLAGSLYMIDDNRPGGSRNQATDGLATAVAPGDEIIWTLLPI 62 K + IL+VVD AAL + L ++Y+ID N+ GS N+ L TA G + W ++ I Sbjct: 2 KKVEILMVVDAAAALASRDLQSNIYLIDTNKYMGSGNEGQAELKTACKDGQLLCWRVVAI 61 Query: 63 ECENHAAI 70 +N I Sbjct: 62 SPDNEVDI 69 >ref|YP_004577859.1| hypothetical protein VAA_00244 [Vibrio anguillarum 775] gb|AEH34902.1| hypothetical protein VAA_00244 [Vibrio anguillarum 775] Length = 131 Score = 47.0 bits (110), Expect = 0.001, Method: Compositional matrix adjust. Identities = 25/68 (36%), Positives = 37/68 (54%) Query: 3 KTINILLVVDVVAALEADTLAGSLYMIDDNRPGGSRNQATDGLATAVAPGDEIIWTLLPI 62 K + IL+VVD AAL + L ++Y+ID N+ GS N+ L TA G + W ++ I Sbjct: 2 KKVEILMVVDAAAALASRDLQSNIYLIDTNKYMGSGNEGQAELKTACKDGQLLCWRVVAI 61 Query: 63 ECENHAAI 70 +N I Sbjct: 62 SPDNEVDI 69 >ref|ZP_07031460.1| hypothetical protein AciX8DRAFT_2765 [Acidobacterium sp. MP5ACTX8] gb|EFI55686.1| hypothetical protein AciX8DRAFT_2765 [Acidobacterium sp. MP5ACTX8] Length = 164 Score = 46.2 bits (108), Expect = 0.002, Method: Compositional matrix adjust. Identities = 24/78 (30%), Positives = 42/78 (53%), Gaps = 2/78 (2%) Query: 1 MTKTINILLVVDVVAALEADTLAGSLYMIDDNRPGGSRNQATDGLATAVAPGDEIIWTLL 60 M+K +NI + VDV+A + + ++++ DD+ P GS + T +AV PG I W L Sbjct: 1 MSK-LNIQIFVDVIAMMTGSPVEKTVFIYDDS-PSGSLGKGTHKAISAVYPGQLIQWNLY 58 Query: 61 PIECENHAAIRAIKLPPE 78 P++ + + I P+ Sbjct: 59 PVDVQTPVWLGGITFGPQ 76 >ref|YP_001508436.1| hypothetical protein Franean1_4144 [Frankia sp. EAN1pec] gb|ABW13530.1| conserved hypothetical protein [Frankia sp. EAN1pec] Length = 130 Score = 42.7 bits (99), Expect = 0.017, Method: Compositional matrix adjust. Identities = 29/109 (26%), Positives = 48/109 (44%), Gaps = 7/109 (6%) Query: 19 ADTLAGSLYMIDDNRPGGSRNQATDGLATAVAPGDEIIWTLLPIECENHAAIRAIK---L 75 A +L ++Y++D N+ GS + +GL+TA G + W ++P+ N I + Sbjct: 17 AGSLGDNVYLVDTNKHFGSSGEGQEGLSTACRDGQLVAWNVVPVSPSNDVQIAEFTGQII 76 Query: 76 PPEICEVRRETYPESDVSYWVGTV--KQPVGDLPYGLTLELGSRMRTLD 122 C + + P+ D YW G V + G Y L L + T D Sbjct: 77 NDGTCVPKLVSTPDGD--YWEGRVEARGTTGYQQYSLVLTMDGTRATFD 123