BLASTP 2.2.21 [Jun-14-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0168.0017.p (159 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,459,386 sequences; 5,307,515,862 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_298906.1| carboxymuconolactone decarboxylase [Ralstonia e... 132 2e-29 ref|YP_001892381.1| Carboxymuconolactone decarboxylase [Ralstoni... 131 3e-29 ref|YP_004005852.1| 4-carboxymuconolactone decarboxylase [Rhodoc... 130 6e-29 ref|ZP_08155878.1| carboxymuconolactone decarboxylase [Rhodococc... 129 1e-28 ref|ZP_08206886.1| hypothetical protein SCNU_19857 [Gordonia neo... 128 3e-28 >ref|YP_298906.1| carboxymuconolactone decarboxylase [Ralstonia eutropha JMP134] gb|AAZ64062.1| Carboxymuconolactone decarboxylase [Ralstonia eutropha JMP134] Length = 135 Score = 132 bits (332), Expect = 2e-29, Method: Compositional matrix adjust. Identities = 61/112 (54%), Positives = 78/112 (69%) Query: 39 ATPACDKMKAVGQWNAAWDPFFELDPIWTDEFMATGAGIYGSGVFSLKEIELLSVAFDAS 98 ATP CD+++ G WN AWDP ELDPIW ++FMA G GV K +E L++A DAS Sbjct: 9 ATPVCDQLRTSGTWNPAWDPIAELDPIWAEKFMAMGMHPVLPGVLEPKVLEFLAIAVDAS 68 Query: 99 YTHMYAPGTRRHIKGALKAGATVEEIMEVLKLCVVQGVQACNLGVPILADEL 150 THMYAPGTRRHI+ AL+ GAT EEI+ VL+ V G+ + +LG PIL +E+ Sbjct: 69 CTHMYAPGTRRHIRKALELGATKEEIVAVLQAVSVLGIHSISLGAPILLEEM 120 Score = 36.2 bits (82), Expect = 1.7, Method: Compositional matrix adjust. Identities = 18/26 (69%), Positives = 20/26 (76%) Query: 2 VLKMASVMSIHSCSLGAPILLEEATA 27 VL+ SV+ IHS SLGAPILLEE A Sbjct: 97 VLQAVSVLGIHSISLGAPILLEEMAA 122 >ref|YP_001892381.1| Carboxymuconolactone decarboxylase [Ralstonia pickettii 12J] ref|YP_002983882.1| carboxymuconolactone decarboxylase [Ralstonia pickettii 12D] gb|ACD28954.1| Carboxymuconolactone decarboxylase [Ralstonia pickettii 12J] gb|ACS65210.1| Carboxymuconolactone decarboxylase [Ralstonia pickettii 12D] Length = 131 Score = 131 bits (330), Expect = 3e-29, Method: Compositional matrix adjust. Identities = 66/128 (51%), Positives = 83/128 (64%), Gaps = 7/128 (5%) Query: 26 TAAGVNPSKKQAPATPACDKMKAVGQWNAAWDPFFELDPIWTDEFMATGAGIYGSGVFSL 85 T A ++PS ATP CD M+A G WN W+PF ELDP WT++FMA G + V Sbjct: 3 TNAPIDPS-----ATPVCDSMRATGNWNPNWEPFAELDPAWTEKFMAMG--VMPHRVLDP 55 Query: 86 KEIELLSVAFDASYTHMYAPGTRRHIKGALKAGATVEEIMEVLKLCVVQGVQACNLGVPI 145 K +E L++A DAS THMYAPG RRHI+ AL+ GAT EEI VL+ V G+ + +LG PI Sbjct: 56 KTLEFLAIAVDASCTHMYAPGVRRHIRKALELGATKEEITAVLQAVSVLGIHSMSLGAPI 115 Query: 146 LADELERR 153 L +EL R Sbjct: 116 LLEELAAR 123 Score = 35.8 bits (81), Expect = 2.2, Method: Compositional matrix adjust. Identities = 18/26 (69%), Positives = 20/26 (76%) Query: 2 VLKMASVMSIHSCSLGAPILLEEATA 27 VL+ SV+ IHS SLGAPILLEE A Sbjct: 97 VLQAVSVLGIHSMSLGAPILLEELAA 122 >ref|YP_004005852.1| 4-carboxymuconolactone decarboxylase [Rhodococcus equi 103S] emb|CBH47167.1| putative 4-carboxymuconolactone decarboxylase [Rhodococcus equi 103S] Length = 127 Score = 130 bits (328), Expect = 6e-29, Method: Compositional matrix adjust. Identities = 59/118 (50%), Positives = 79/118 (66%) Query: 33 SKKQAPATPACDKMKAVGQWNAAWDPFFELDPIWTDEFMATGAGIYGSGVFSLKEIELLS 92 + + +TP +M+ G WN WD + DP WT++FMA A GVF + +ELLS Sbjct: 3 TNPEPTSTPTISRMQQEGSWNPLWDTLSQWDPEWTEQFMAMNATPIRRGVFPPEFVELLS 62 Query: 93 VAFDASYTHMYAPGTRRHIKGALKAGATVEEIMEVLKLCVVQGVQACNLGVPILADEL 150 +A DA+ THMYAPG RRHI+ AL+ G T E+I+ VL++ V G+ ACNLGVPILA+EL Sbjct: 63 IAIDAAATHMYAPGVRRHIRAALELGVTREQILTVLQMVSVLGIHACNLGVPILAEEL 120 Score = 37.7 bits (86), Expect = 0.60, Method: Compositional matrix adjust. Identities = 17/31 (54%), Positives = 21/31 (67%) Query: 2 VLKMASVMSIHSCSLGAPILLEEATAAGVNP 32 VL+M SV+ IH+C+LG PIL EE A P Sbjct: 97 VLQMVSVLGIHACNLGVPILAEELAAMEARP 127 >ref|ZP_08155878.1| carboxymuconolactone decarboxylase [Rhodococcus equi ATCC 33707] gb|EGD22664.1| carboxymuconolactone decarboxylase [Rhodococcus equi ATCC 33707] Length = 127 Score = 129 bits (325), Expect = 1e-28, Method: Compositional matrix adjust. Identities = 59/111 (53%), Positives = 76/111 (68%) Query: 40 TPACDKMKAVGQWNAAWDPFFELDPIWTDEFMATGAGIYGSGVFSLKEIELLSVAFDASY 99 TP +M+ G WN WD + DP WT++FMA A GVF + +ELLS+A DA+ Sbjct: 10 TPTISRMQQDGSWNPLWDTLSQWDPEWTEQFMAMNATPIRRGVFPPEFVELLSIAIDAAA 69 Query: 100 THMYAPGTRRHIKGALKAGATVEEIMEVLKLCVVQGVQACNLGVPILADEL 150 THMYAPG RRHI+ AL+ G T E+I+ VL++ V G+ ACNLGVPILA+EL Sbjct: 70 THMYAPGVRRHIRAALELGVTREQILTVLQMVSVLGIHACNLGVPILAEEL 120 Score = 37.7 bits (86), Expect = 0.55, Method: Compositional matrix adjust. Identities = 17/31 (54%), Positives = 21/31 (67%) Query: 2 VLKMASVMSIHSCSLGAPILLEEATAAGVNP 32 VL+M SV+ IH+C+LG PIL EE A P Sbjct: 97 VLQMVSVLGIHACNLGVPILAEELAAMEARP 127 >ref|ZP_08206886.1| hypothetical protein SCNU_19857 [Gordonia neofelifaecis NRRL B-59395] gb|EGD53249.1| hypothetical protein SCNU_19857 [Gordonia neofelifaecis NRRL B-59395] Length = 141 Score = 128 bits (321), Expect = 3e-28, Method: Compositional matrix adjust. Identities = 58/113 (51%), Positives = 77/113 (68%) Query: 41 PACDKMKAVGQWNAAWDPFFELDPIWTDEFMATGAGIYGSGVFSLKEIELLSVAFDASYT 100 P + MK G WN WD +++DP WT+++MA Y SGV S K ++LL +A DA+ T Sbjct: 16 PVVEGMKESGAWNELWDGVYDMDPDWTEQYMAAAMEPYLSGVLSPKVVQLLCIAVDAAAT 75 Query: 101 HMYAPGTRRHIKGALKAGATVEEIMEVLKLCVVQGVQACNLGVPILADELERR 153 HMYAPGTRRH++ AL G T EEI+EVLKL + GV +CN+G PIL +E+ R Sbjct: 76 HMYAPGTRRHMQAALDMGVTPEEILEVLKLTTLVGVHSCNVGAPILIEEMAAR 128 Score = 42.4 bits (98), Expect = 0.026, Method: Compositional matrix adjust. Identities = 16/34 (47%), Positives = 26/34 (76%) Query: 2 VLKMASVMSIHSCSLGAPILLEEATAAGVNPSKK 35 VLK+ +++ +HSC++GAPIL+EE A G+ P + Sbjct: 102 VLKLTTLVGVHSCNVGAPILIEEMAARGLRPQSR 135