BLASTP 2.2.21 [Jun-14-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0094.0098.p (44 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,459,386 sequences; 5,307,515,862 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_001639819.1| 50S ribosomal protein L34 [Methylobacterium ... 77 7e-13 ref|ZP_04680972.1| ribosomal protein L34 [Ochrobactrum intermedi... 77 9e-13 ref|YP_989321.1| ribosomal protein L34 [Bartonella bacilliformis... 77 9e-13 ref|NP_541254.1| 50S ribosomal protein L34 [Brucella melitensis ... 77 1e-12 ref|NP_384552.1| 50S ribosomal protein L34 [Sinorhizobium melilo... 76 2e-12 >ref|YP_001639819.1| 50S ribosomal protein L34 [Methylobacterium extorquens PA1] ref|YP_001925007.1| 50S ribosomal protein L34 [Methylobacterium populi BJ001] ref|YP_002421400.1| 50S ribosomal protein L34 [Methylobacterium chloromethanicum CM4] ref|YP_002963416.1| 50S ribosomal subunit protein L34 [methylobacterium extorquens AM1] sp|A9W592.1|RL34_METEP RecName: Full=50S ribosomal protein L34 sp|B1Z8E9.1|RL34_METPB RecName: Full=50S ribosomal protein L34 sp|B7L2I7.1|RL34_METC4 RecName: Full=50S ribosomal protein L34 gb|ABY30748.1| ribosomal protein L34 [Methylobacterium extorquens PA1] gb|ACB80472.1| ribosomal protein L34 [Methylobacterium populi BJ001] gb|ACK83472.1| ribosomal protein L34 [Methylobacterium chloromethanicum CM4] gb|ACS40139.1| 50S ribosomal subunit protein L34 [Methylobacterium extorquens AM1] Length = 44 Score = 77.4 bits (189), Expect = 7e-13, Method: Compositional matrix adjust. Identities = 40/44 (90%), Positives = 43/44 (97%) Query: 1 VKRTYQPSKLVRKRRHGFRARLATAGGRKVLAARRARGRKRLSA 44 +KRTYQPSKLVRKRRHGFRAR+ATAGGRKV+AARRA GRKRLSA Sbjct: 1 MKRTYQPSKLVRKRRHGFRARMATAGGRKVIAARRAHGRKRLSA 44 >ref|ZP_04680972.1| ribosomal protein L34 [Ochrobactrum intermedium LMG 3301] gb|EEQ96478.1| ribosomal protein L34 [Ochrobactrum intermedium LMG 3301] Length = 44 Score = 77.0 bits (188), Expect = 9e-13, Method: Compositional matrix adjust. Identities = 39/44 (88%), Positives = 43/44 (97%) Query: 1 VKRTYQPSKLVRKRRHGFRARLATAGGRKVLAARRARGRKRLSA 44 +KRTYQPSK+VRKRRHGFRAR+AT GGRKVLAARR+RGRKRLSA Sbjct: 1 MKRTYQPSKIVRKRRHGFRARMATTGGRKVLAARRSRGRKRLSA 44 >ref|YP_989321.1| ribosomal protein L34 [Bartonella bacilliformis KC583] sp|A1UTL8.1|RL34_BARBK RecName: Full=50S ribosomal protein L34 gb|ABM44425.1| ribosomal protein L34 [Bartonella bacilliformis KC583] Length = 44 Score = 77.0 bits (188), Expect = 9e-13, Method: Compositional matrix adjust. Identities = 40/44 (90%), Positives = 43/44 (97%) Query: 1 VKRTYQPSKLVRKRRHGFRARLATAGGRKVLAARRARGRKRLSA 44 +KRTYQPSKLVRKRRHGFRAR+ATAGGRKV+AARR RGRKRLSA Sbjct: 1 MKRTYQPSKLVRKRRHGFRARMATAGGRKVIAARRLRGRKRLSA 44 >ref|NP_541254.1| 50S ribosomal protein L34 [Brucella melitensis bv. 1 str. 16M] ref|NP_700184.1| 50S ribosomal protein L34 [Brucella suis 1330] ref|YP_223703.1| 50S ribosomal protein L34 [Brucella abortus bv. 1 str. 9-941] ref|YP_419120.1| 50S ribosomal protein L34 [Brucella melitensis biovar Abortus 2308] ref|YP_001257932.1| 50S ribosomal protein L34 [Brucella ovis ATCC 25840] ref|YP_001594955.1| 50S ribosomal protein L34 [Brucella canis ATCC 23365] ref|YP_001622790.1| 50S ribosomal protein L34 [Brucella suis ATCC 23445] ref|ZP_03787503.1| ribosomal protein L34 [Brucella ceti str. Cudo] ref|YP_002734748.1| 50S ribosomal protein L34 [Brucella melitensis ATCC 23457] ref|ZP_04596382.1| ribosomal protein L34 [Brucella abortus str. 2308 A] ref|YP_003105789.1| 50S ribosomal protein L34 [Brucella microti CCM 4915] ref|ZP_05464622.1| 50S ribosomal protein L34 [Brucella melitensis bv. 2 str. 63/9] ref|ZP_05820906.1| predicted protein [Brucella abortus NCTC 8038] ref|ZP_05835551.1| predicted protein [Brucella melitensis bv. 1 str. 16M] ref|ZP_05838202.1| predicted protein [Brucella suis bv. 4 str. 40] ref|ZP_05868583.1| predicted protein [Brucella abortus bv. 6 str. 870] ref|ZP_05872744.1| 50S ribosomal protein L34 [Brucella abortus bv. 4 str. 292] ref|ZP_05875968.1| 50S ribosomal protein L34 [Brucella abortus bv. 2 str. 86/8/59] ref|ZP_05893673.1| 50S ribosomal protein L34 [Brucella abortus bv. 9 str. C68] ref|ZP_05930744.1| predicted protein [Brucella abortus bv. 3 str. Tulya] ref|ZP_05931888.1| 50S ribosomal protein L34 [Brucella ceti M13/05/1] ref|ZP_05935112.1| 50S ribosomal protein L34 [Brucella ceti B1/94] ref|ZP_05952123.1| predicted protein [Brucella pinnipedialis M163/99/10] ref|ZP_05957518.1| predicted protein [Brucella pinnipedialis B2/94] ref|ZP_05959681.1| 50S ribosomal protein L34 [Brucella ceti M644/93/1] ref|ZP_05961953.1| 50S ribosomal protein L34 [Brucella neotomae 5K33] ref|ZP_05994420.1| 50S ribosomal protein L34 [Brucella suis bv. 5 str. 513] ref|ZP_05997676.1| ribosomal protein L34 [Brucella suis bv. 3 str. 686] ref|ZP_06000918.1| ribosomal protein L34 [Brucella sp. F5/99] ref|ZP_06097892.1| predicted protein [Brucella sp. 83/13] ref|ZP_06098676.1| 50S ribosomal protein L34 [Brucella pinnipedialis M292/94/1] ref|ZP_06102869.1| 50S ribosomal protein L34 [Brucella melitensis bv. 1 str. Rev.1] ref|ZP_06105138.1| 50S ribosomal protein L34 [Brucella melitensis bv. 3 str. Ether] ref|ZP_06108370.1| 50S ribosomal protein L34 [Brucella ceti M490/95/1] ref|ZP_06794646.1| 50S ribosomal protein L34 [Brucella sp. NVSL 07-0026] ref|ZP_06932915.1| 50S ribosomal protein L34 [Brucella abortus bv. 5 str. B3196] ref|ZP_07472350.1| ribosomal protein L34 [Brucella sp. NF 2653] ref|ZP_07473667.1| ribosomal protein L34 [Brucella sp. BO2] ref|ZP_07478786.1| ribosomal protein L34 [Brucella sp. BO1] ref|YP_004758247.1| 50S ribosomal protein L34 [Brucella pinnipedialis B2/94] sp|P66243.1|RL34_BRUSU RecName: Full=50S ribosomal protein L34 sp|P66242.1|RL34_BRUME RecName: Full=50S ribosomal protein L34 sp|Q576U2.1|RL34_BRUAB RecName: Full=50S ribosomal protein L34 sp|Q2YJR4.1|RL34_BRUA2 RecName: Full=50S ribosomal protein L34 sp|A5VVS7.1|RL34_BRUO2 RecName: Full=50S ribosomal protein L34 sp|A9MCU7.1|RL34_BRUC2 RecName: Full=50S ribosomal protein L34 sp|A9WW32.1|RL34_BRUSI RecName: Full=50S ribosomal protein L34 sp|C0RMG1.1|RL34_BRUMB RecName: Full=50S ribosomal protein L34 gb|AAL53518.1| lsu ribosomal protein l34p [Brucella melitensis bv. 1 str. 16M] gb|AAN34189.1| ribosomal protein L34 [Brucella suis 1330] gb|AAX76342.1| RpmH, ribosomal protein L34 [Brucella abortus bv. 1 str. 9-941] emb|CAJ13150.1| Ribosomal protein L34 [Brucella melitensis biovar Abortus 2308] gb|ABQ62216.1| ribosomal protein L34 [Brucella ovis ATCC 25840] gb|ABX64184.1| ribosomal protein L34 [Brucella canis ATCC 23365] gb|ABY39968.1| ribosomal protein L34 [Brucella suis ATCC 23445] gb|EEH13015.1| ribosomal protein L34 [Brucella ceti str. Cudo] gb|ACO02794.1| ribosomal protein L34 [Brucella melitensis ATCC 23457] gb|EEP62419.1| ribosomal protein L34 [Brucella abortus str. 2308 A] gb|ACU50127.1| 50S ribosomal protein L34 [Brucella microti CCM 4915] gb|EEW82230.1| predicted protein [Brucella abortus NCTC 8038] gb|EEW87802.1| predicted protein [Brucella melitensis bv. 1 str. 16M] gb|EEW89479.1| predicted protein [Brucella suis bv. 4 str. 40] gb|EEX57654.1| 50S ribosomal protein L34 [Brucella abortus bv. 4 str. 292] gb|EEX60878.1| 50S ribosomal protein L34 [Brucella abortus bv. 2 str. 86/8/59] gb|EEX63164.1| predicted protein [Brucella abortus bv. 6 str. 870] gb|EEX78656.1| 50S ribosomal protein L34 [Brucella abortus bv. 9 str. C68] gb|EEX84931.1| predicted protein [Brucella abortus bv. 3 str. Tulya] gb|EEX86068.1| 50S ribosomal protein L34 [Brucella ceti B1/94] gb|EEX89264.1| 50S ribosomal protein L34 [Brucella ceti M13/05/1] gb|EEX96670.1| 50S ribosomal protein L34 [Brucella ceti M644/93/1] gb|EEY01041.1| predicted protein [Brucella pinnipedialis B2/94] gb|EEY02233.1| 50S ribosomal protein L34 [Brucella neotomae 5K33] gb|EEY05449.1| predicted protein [Brucella pinnipedialis M163/99/10] gb|EEY25189.1| ribosomal protein L34 [Brucella sp. F5/99] gb|EEY28390.1| 50S ribosomal protein L34 [Brucella suis bv. 5 str. 513] gb|EEY31646.1| ribosomal protein L34 [Brucella suis bv. 3 str. 686] gb|EEZ06271.1| 50S ribosomal protein L34 [Brucella ceti M490/95/1] gb|EEZ09483.1| 50S ribosomal protein L34 [Brucella melitensis bv. 3 str. Ether] gb|EEZ13671.1| 50S ribosomal protein L34 [Brucella melitensis bv. 1 str. Rev.1] gb|EEZ16110.1| 50S ribosomal protein L34 [Brucella melitensis bv. 2 str. 63/9] gb|EEZ28577.1| 50S ribosomal protein L34 [Brucella pinnipedialis M292/94/1] gb|EEZ34010.1| predicted protein [Brucella sp. 83/13] gb|EFG36629.1| 50S ribosomal protein L34 [Brucella sp. NVSL 07-0026] gb|EFH32447.1| 50S ribosomal protein L34 [Brucella abortus bv. 5 str. B3196] gb|EFM55336.1| ribosomal protein L34 [Brucella sp. BO1] gb|EFM60310.1| ribosomal protein L34 [Brucella sp. BO2] gb|EFM61647.1| ribosomal protein L34 [Brucella sp. NF 2653] gb|ADZ68248.1| 50S ribosomal protein L34 [Brucella melitensis M28] gb|ADZ89114.1| 50S ribosomal protein L34 [Brucella melitensis M5-90] gb|AEK56479.1| 50S ribosomal protein L34 [Brucella pinnipedialis B2/94] gb|AEM20465.1| 50S ribosomal protein L34 [Brucella suis 1330] Length = 44 Score = 76.6 bits (187), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 39/44 (88%), Positives = 42/44 (95%) Query: 1 VKRTYQPSKLVRKRRHGFRARLATAGGRKVLAARRARGRKRLSA 44 +KRTYQPSK+VRKRRHGFRAR+AT GGRKVLAARR RGRKRLSA Sbjct: 1 MKRTYQPSKIVRKRRHGFRARMATTGGRKVLAARRTRGRKRLSA 44 >ref|NP_384552.1| 50S ribosomal protein L34 [Sinorhizobium meliloti 1021] ref|YP_001325776.1| 50S ribosomal protein L34 [Sinorhizobium medicae WSM419] ref|YP_004547467.1| 50S ribosomal protein L34 [Sinorhizobium meliloti AK83] sp|Q92SF3.1|RL34_RHIME RecName: Full=50S ribosomal protein L34 sp|A6U5L1.1|RL34_SINMW RecName: Full=50S ribosomal protein L34 emb|CAC41883.1| Probable 50S ribosomal protein L34 [Sinorhizobium meliloti 1021] gb|ABR58941.1| ribosomal protein L34 [Sinorhizobium medicae WSM419] gb|AEG03029.1| 50S ribosomal protein L34 [Sinorhizobium meliloti BL225C] gb|AEG51853.1| 50S ribosomal protein L34 [Sinorhizobium meliloti AK83] gb|AEH77367.1| 50S ribosomal protein L34 [Sinorhizobium meliloti SM11] Length = 44 Score = 75.9 bits (185), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 39/44 (88%), Positives = 42/44 (95%) Query: 1 VKRTYQPSKLVRKRRHGFRARLATAGGRKVLAARRARGRKRLSA 44 +KRTYQPSKLVRKRRHGFRAR++T GGRKVL ARRARGRKRLSA Sbjct: 1 MKRTYQPSKLVRKRRHGFRARMSTKGGRKVLTARRARGRKRLSA 44