BLASTP 2.2.21 [Jun-14-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 0030.0002.p (118 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 15,459,386 sequences; 5,307,515,862 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_004721217.1| Rieske (2Fe-2S) iron-sulfur domain-containin... 97 1e-18 ref|NP_670611.1| hypothetical protein y3312 [Yersinia pestis KIM... 94 6e-18 ref|ZP_04638728.1| hypothetical protein yinte0001_42530 [Yersini... 94 6e-18 ref|ZP_04642105.1| hypothetical protein ymoll0001_31250 [Yersini... 94 8e-18 ref|YP_045700.1| ferredoxin [Acinetobacter sp. ADP1] >gi|2271505... 94 8e-18 >ref|YP_004721217.1| Rieske (2Fe-2S) iron-sulfur domain-containing protein [Sulfobacillus acidophilus TPY] gb|AEJ41474.1| Rieske (2Fe-2S) iron-sulfur domain protein [Sulfobacillus acidophilus TPY] Length = 102 Score = 96.7 bits (239), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 46/102 (45%), Positives = 66/102 (64%), Gaps = 1/102 (0%) Query: 1 MTWHHLCAAAKLSEGEPLGFWVGERRIALYKVDDDVFATDDVCSHAFALLSTGFLEGHVI 60 M W + A ++ EG+P+ VGE IALY+V D++FAT+D+CSHA A LS G G++I Sbjct: 1 MAWQPVAQADEIREGQPVLVVVGEDDIALYRVQDEIFATEDLCSHAEASLSEGDQHGYII 60 Query: 61 ECPLHGAMFDVRDGKCRS-SAYRDIEAFKVEIRDGEVYVQLD 101 ECP HG FD+R GK + A I + V+I +G V++ +D Sbjct: 61 ECPRHGGRFDIRTGKAKHFPAVSPIRTYPVKIENGTVFIAVD 102 >ref|NP_670611.1| hypothetical protein y3312 [Yersinia pestis KIM 10] ref|NP_994791.1| putative Rieske protein [Yersinia pestis biovar Microtus str. 91001] ref|YP_071701.1| Rieske protein. [Yersinia pseudotuberculosis IP 32953] ref|YP_650251.1| putative Rieske protein [Yersinia pestis Antiqua] ref|YP_649052.1| Rieske protein [Yersinia pestis Nepal516] ref|YP_001161970.1| Rieske protein [Yersinia pestis Pestoides F] ref|ZP_01889095.1| putative Rieske protein [Yersinia pestis CA88-4125] ref|YP_001399828.1| Rieske family iron-sulfur cluster-binding protein [Yersinia pseudotuberculosis IP 31758] ref|YP_001607693.1| Rieske family iron-sulfur cluster-binding protein [Yersinia pestis Angola] ref|ZP_02220823.1| iron-sulfur cluster-binding protein, Rieske family [Yersinia pestis biovar Orientalis str. F1991016] ref|ZP_02225805.1| iron-sulfur cluster-binding protein, Rieske family [Yersinia pestis biovar Orientalis str. IP275] ref|ZP_02231247.1| iron-sulfur cluster-binding protein, Rieske family [Yersinia pestis biovar Antiqua str. E1979001] ref|ZP_02238800.1| iron-sulfur cluster-binding protein, Rieske family [Yersinia pestis biovar Antiqua str. B42003004] ref|ZP_02305269.1| iron-sulfur cluster-binding protein, Rieske family [Yersinia pestis biovar Antiqua str. UG05-0454] ref|ZP_02313673.1| iron-sulfur cluster-binding protein, Rieske family [Yersinia pestis biovar Orientalis str. MG05-1020] ref|ZP_02318451.1| iron-sulfur cluster-binding protein, Rieske family [Yersinia pestis biovar Mediaevalis str. K1973002] ref|ZP_02335081.1| iron-sulfur cluster-binding protein, Rieske family [Yersinia pestis FV-1] ref|YP_001873744.1| Rieske (2Fe-2S) domain-containing protein [Yersinia pseudotuberculosis PB1/+] ref|YP_002345976.1| putative Rieske protein [Yersinia pestis CO92] ref|ZP_04457779.1| putative Rieske protein [Yersinia pestis Pestoides A] ref|ZP_04461003.1| putative Rieske protein [Yersinia pestis biovar Orientalis str. PEXU2] ref|ZP_04462751.1| putative Rieske protein [Yersinia pestis biovar Orientalis str. India 195] ref|ZP_04518858.1| putative Rieske protein [Yersinia pestis Nepal516] ref|ZP_06204599.1| Rieske (2Fe-2S) domain protein [Yersinia pestis KIM D27] ref|YP_003566970.1| putative Rieske protein [Yersinia pestis Z176003] gb|AAM86862.1|AE013932_5 hypothetical [Yersinia pestis KIM 10] gb|AAS63668.1| putative Rieske protein [Yersinia pestis biovar Microtus str. 91001] emb|CAH22438.1| Putative Rieske protein [Yersinia pseudotuberculosis IP 32953] gb|ABG19452.1| Rieske protein [Yersinia pestis Nepal516] gb|ABG12306.1| putative Rieske protein [Yersinia pestis Antiqua] emb|CAL19595.1| putative Rieske protein [Yersinia pestis CO92] gb|ABP38997.1| Rieske protein [Yersinia pestis Pestoides F] gb|EDM40752.1| putative Rieske protein [Yersinia pestis CA88-4125] gb|ABS49026.1| iron-sulfur cluster-binding protein, Rieske family [Yersinia pseudotuberculosis IP 31758] gb|ABX85646.1| iron-sulfur cluster-binding protein, Rieske family [Yersinia pestis Angola] gb|EDR33328.1| iron-sulfur cluster-binding protein, Rieske family [Yersinia pestis biovar Orientalis str. IP275] gb|EDR40342.1| iron-sulfur cluster-binding protein, Rieske family [Yersinia pestis biovar Orientalis str. F1991016] gb|EDR43136.1| iron-sulfur cluster-binding protein, Rieske family [Yersinia pestis biovar Antiqua str. E1979001] gb|EDR50537.1| iron-sulfur cluster-binding protein, Rieske family [Yersinia pestis biovar Antiqua str. B42003004] gb|EDR56078.1| iron-sulfur cluster-binding protein, Rieske family [Yersinia pestis biovar Orientalis str. MG05-1020] gb|EDR61867.1| iron-sulfur cluster-binding protein, Rieske family [Yersinia pestis biovar Antiqua str. UG05-0454] gb|EDR64120.1| iron-sulfur cluster-binding protein, Rieske family [Yersinia pestis biovar Mediaevalis str. K1973002] gb|ACC90287.1| Rieske (2Fe-2S) domain protein [Yersinia pseudotuberculosis PB1/+] gb|EEO75618.1| putative Rieske protein [Yersinia pestis Nepal516] gb|EEO82960.1| putative Rieske protein [Yersinia pestis biovar Orientalis str. India 195] gb|EEO87257.1| putative Rieske protein [Yersinia pestis biovar Orientalis str. PEXU2] gb|EEO91316.1| putative Rieske protein [Yersinia pestis Pestoides A] gb|ACY57664.1| putative Rieske protein [Yersinia pestis D106004] gb|ACY61440.1| putative Rieske protein [Yersinia pestis D182038] gb|EFA46806.1| Rieske (2Fe-2S) domain protein [Yersinia pestis KIM D27] gb|ADE63708.1| putative Rieske protein [Yersinia pestis Z176003] gb|ADV97563.1| putative Rieske protein [Yersinia pestis biovar Medievalis str. Harbin 35] gb|AEL70758.1| putative Rieske protein [Yersinia pestis A1122] Length = 106 Score = 94.4 bits (233), Expect = 6e-18, Method: Compositional matrix adjust. Identities = 42/103 (40%), Positives = 60/103 (58%), Gaps = 1/103 (0%) Query: 1 MTWHHLCAAAKLSEGEPLGFWVGERRIALYKVDDDVFATDDVCSHAFALLSTGFLEGHVI 60 M W +C + P G R+ +Y V+ + FA +D+C HA+ALLS G +G +I Sbjct: 1 MGWFSVCKVNDIKPDFPFSAQAGNNRVGIYLVEGEYFAMEDICPHAYALLSQGINDGEII 60 Query: 61 ECPLHGAMFDVRDGKC-RSSAYRDIEAFKVEIRDGEVYVQLDG 102 ECPLHGA+F+VR G+C R RD+ + V I ++ V LDG Sbjct: 61 ECPLHGALFNVRTGQCLREPGDRDLNTYAVRINGDQIDVNLDG 103 >ref|ZP_04638728.1| hypothetical protein yinte0001_42530 [Yersinia intermedia ATCC 29909] gb|EEQ17101.1| hypothetical protein yinte0001_42530 [Yersinia intermedia ATCC 29909] Length = 107 Score = 94.0 bits (232), Expect = 6e-18, Method: Compositional matrix adjust. Identities = 42/101 (41%), Positives = 61/101 (60%), Gaps = 1/101 (0%) Query: 1 MTWHHLCAAAKLSEGEPLGFWVGERRIALYKVDDDVFATDDVCSHAFALLSTGFLEGHVI 60 M W +C + P + ++RI +Y +D + FA D+C HA ALLS GF++G + Sbjct: 1 MGWVSVCKVNYVKPDFPFSAQIDDKRIGIYIIDGEYFAMQDICPHANALLSQGFMDGETV 60 Query: 61 ECPLHGAMFDVRDGKC-RSSAYRDIEAFKVEIRDGEVYVQL 100 ECPLHGA+FDVR G+C R RD+E + V I+ ++ V L Sbjct: 61 ECPLHGALFDVRTGQCLREPGDRDLETYPVRIKGDQIEVDL 101 >ref|ZP_04642105.1| hypothetical protein ymoll0001_31250 [Yersinia mollaretii ATCC 43969] gb|EEQ09357.1| hypothetical protein ymoll0001_31250 [Yersinia mollaretii ATCC 43969] Length = 105 Score = 93.6 bits (231), Expect = 8e-18, Method: Compositional matrix adjust. Identities = 44/104 (42%), Positives = 61/104 (58%), Gaps = 1/104 (0%) Query: 1 MTWHHLCAAAKLSEGEPLGFWVGERRIALYKVDDDVFATDDVCSHAFALLSTGFLEGHVI 60 M W +C + P ++RI +Y VD + FA +D+C HA ALLS GF++G I Sbjct: 1 MGWFSVCKVNYVKPDSPFSAKADDKRIGIYLVDGEYFAMEDICPHANALLSQGFVDGATI 60 Query: 61 ECPLHGAMFDVRDGKC-RSSAYRDIEAFKVEIRDGEVYVQLDGG 103 ECPLHGA+FD+R G+C R RD+E + V I ++ V L G Sbjct: 61 ECPLHGALFDIRSGQCLREPGDRDLEVYPVRINGDQIEVDLGEG 104 >ref|YP_045700.1| ferredoxin [Acinetobacter sp. ADP1] gb|AAC27112.1| unknown [Acinetobacter sp. ADP1] emb|CAG67878.1| putative ferredoxin [Acinetobacter sp. ADP1] Length = 101 Score = 93.6 bits (231), Expect = 8e-18, Method: Compositional matrix adjust. Identities = 38/101 (37%), Positives = 66/101 (65%), Gaps = 1/101 (0%) Query: 1 MTWHHLCAAAKLSEGEPLGFWVGERRIALYKVDDDVFATDDVCSHAFALLSTGFLEGHVI 60 M+W +C +SE EP + +++I ++ +D++ FA ++VC HAFALL+ GF+E + Sbjct: 1 MSWISVCGIDDVSEDEPKAVEINDKKIGVFVIDENYFAIENVCPHAFALLTEGFIEDQTV 60 Query: 61 ECPLHGAMFDVRDGKCRS-SAYRDIEAFKVEIRDGEVYVQL 100 ECPLH A+FD++ G+ +S RD+ + V + D ++ +QL Sbjct: 61 ECPLHEAIFDIQTGQLKSGPGCRDLCTYPVRVEDQQIQIQL 101